[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07071.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----111-----1-1-11------------------------------------------------------------------------------------1--1-1-------1-------------------------------------------------------------------------------------------------------------------------------------------------------------1---111--111--------------11111------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSVSENKLENPCLGAPRPAVHRTGWPRPNPCHAWAGGRSATPGNMRADSSMPPRTDLARS:Sequence 61: . . . * . .: 120 :RRVTVVHNWSRRVFVVITTLTFVAILGGCNAMKLGYEQGDRLAYWWVDRYVDVSDAQEVP:Sequence 121: . . + . . .: 180 :TRDAIARFFAWHRRSQLPEVAKVLARVKGEVAGPVDIAMIRQAQQDSQRLGRQAYENTIP:Sequence 181: . * . . . .: 240 :DLADLMLTLSPDQIKRMETKFAESNTKYRKQFLGSDADARTDARFDKIMDYTKLVYGSFS:Sequence 241: + . . . . *: 300 :RDQEKAIRDAMGPYMLNADARYSERVRRQQEWVALAREISTTRPPKAQAEEMLRHYADDW:Sequence 301: . . . . + .: 360 :QRPATGQQRSTDAGINLTVTIANLTTPEQKAHAVKRFQGWIEDVQALMREPGRSTRASQ :Sequence