[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF07071.1 rmet0 ABF07071.1 "conserved hypothetical protein"
MSVSENKLENPCLGAPRPAVHRTGWPRPNPCHAWAGGRSATPGNMRADSSMPPRTDLARS
RRVTVVHNWSRRVFVVITTLTFVAILGGCNAMKLGYEQGDRLAYWWVDRYVDVSDAQEVP
TRDAIARFFAWHRRSQLPEVAKVLARVKGEVAGPVDIAMIRQAQQDSQRLGRQAYENTIP
DLADLMLTLSPDQIKRMETKFAESNTKYRKQFLGSDADARTDARFDKIMDYTKLVYGSFS
RDQEKAIRDAMGPYMLNADARYSERVRRQQEWVALAREISTTRPPKAQAEEMLRHYADDW
QRPATGQQRSTDAGINLTVTIANLTTPEQKAHAVKRFQGWIEDVQALMREPGRSTRASQ
//