[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07116.1"

            "two component, sigma54 specific, transcriptional regulator, Fis family"
            ""

OrgPattern ------------------------2----1-------------22--111------------------ ASO2--1-1121-121111-11111-11111121112121112-12---112111--2--1311214341----------2-373965999A27331--336356I5D851111111111111113338535777411-751115-1112-----111--112-11-223-----12-----1---11--161488888778587787799666588826A2711323333P4--------------------5----1-----11------2----------------------------------------1----------HJ3KDCCEDCE7D7-N445112161-1A-141bY9JE92DA5A7A112-GHG855712222GDMEF777FGBAD55455554559-CCDADDDD5B81BAAABCABEACBJK55386CDBDE66844444444B5524B8F11111122--111111111111111----26ACB57A76DSQSQRPJEEEEOOUSHIGGBFORQJNKH22EGEILCABIHHLGA88JDF9ACA22111-1576MQPDs*UORueHmZoop6hijfaanOVegijt*Lh-111-1111111111111111311-DCFBAACCKCCA8GEDDDEHHIGEGIDIIFLI--2EIBK------F9ACA76ECCFEDFGEE-CFDDGEEEDDCDFEEDEEDEEEAA886EDDCCEFFEFECGCCEBA97BABA4-766787766898---5-----3333C6RAL1112111111111123345326122U9RSSSNVVQRQSRNIRPN-----1---69EFJFFFGFINIJJ78BA9AA8883333--F13355551111111152--------------------------131111111-8B3 -1------------------------------------------------------------------------------------------------------------------------------------------------------------4----1------3--3-----------1--6-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIAMQDGLRVLFVEDEPLVRQATAQSLELAGFSVLALPSAEAAMPHLGADFPGVLVTDVR:Sequence :ccEEEEcEEEEEEcccHHHHHHHHHHHHHcEEEEEccccccccEEEEEcGGGTTTccccH:Sec Str : =======================================================:RP:SCP|6->74|1cvrA1|6e-08|6.1|66/82|b.1.18.12 : ===================================================:BL:SWS|10->444|DCTD_RHIME|e-109|48.2|434/460 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->110|PF00072|2e-14|33.7|101/111|Response_reg 61: . . . * . .: 120 :LSGASGLDLLQHCRNAAPGVPVILVTGHGDITMAVQAMREGAYDFIEKPFGADRLTETVR:Sequence :HHHTHHHHHTTccEEEETTcEEEEEETTEEEEEEEEEEccccEEEEcTTccccccccccc:Sec Str : XXXXXXX:SEG|114->140|rltetvrralerralelenhalrrela :============== :RP:SCP|6->74|1cvrA1|6e-08|6.1|66/82|b.1.18.12 : =====================================================:RP:SCP|68->344|1lt7A|1e-47|9.0|268/305|c.1.26.1 :============================================================:BL:SWS|10->444|DCTD_RHIME|e-109|48.2|434/460 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|10->110|PF00072|2e-14|33.7|101/111|Response_reg 121: . . + . . .: 180 :RALERRALELENHALRRELAGPAAGTRIIGRSPAIAQVRDLIANVAATDVPVMINGETGT:Sequence :ccTTcccTTcccGGGcccccHHHHHGHHHHHHHHHHcHHHHHHcccccccEEEEEccTTc:Sec Str :XXXXXXXXXXXXXXXXXXXX :SEG|114->140|rltetvrralerralelenhalrrela : #########:PROS|172->185|PS00675|SIGMA54_INTERACT_1|PDOC00579| :============================================================:RP:SCP|68->344|1lt7A|1e-47|9.0|268/305|c.1.26.1 :============================================================:BL:SWS|10->444|DCTD_RHIME|e-109|48.2|434/460 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|148->314|PF00158|8e-54|62.3|167/168|Sigma54_activat 181: . * . . . .: 240 :GKELVARSLHALSTRRDQPFIALNCGAVPESIFESEMFGHEAGAFTGAGKRRVGKLEHAS:Sequence :cHHHHHHHHHcHHHHHTTcEEEEEcHHHHTTccTTHHHHHHHHHHHHHHHHHHHHHHHTc:Sec Str :##### :PROS|172->185|PS00675|SIGMA54_INTERACT_1|PDOC00579| : #######:PROS|234->249|PS00676|SIGMA54_INTERACT_2|PDOC00579| :============================================================:RP:SCP|68->344|1lt7A|1e-47|9.0|268/305|c.1.26.1 :============================================================:BL:SWS|10->444|DCTD_RHIME|e-109|48.2|434/460 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|148->314|PF00158|8e-54|62.3|167/168|Sigma54_activat 241: + . . . . *: 300 :GGTLFLDEIESMPLALQVKLLRVLQEGTLERLGSNTSIPIDVRIIAASKGDMEALVAQGT:Sequence :cEEEEEccGGGTccHHHHcccTTHHHHHHHHHHHHHTccccccEEEEEEEccGGGccGGG:Sec Str :######### :PROS|234->249|PS00676|SIGMA54_INTERACT_2|PDOC00579| :============================================================:RP:SCP|68->344|1lt7A|1e-47|9.0|268/305|c.1.26.1 :============================================================:BL:SWS|10->444|DCTD_RHIME|e-109|48.2|434/460 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|148->314|PF00158|8e-54|62.3|167/168|Sigma54_activat 301: . . . . + .: 360 :FRQDLLYRLNVVTIPLPPLRERREDIVPLFEHFMLVAAVRYQRPAPILSEMQRQQLMQRP:Sequence :TcTTcccEEEEcccccHHHHHHHHHHTTTccccTTccHHHHHHHcTTccHHHHHHHHHHH:Sec Str :============================================ :RP:SCP|68->344|1lt7A|1e-47|9.0|268/305|c.1.26.1 : =:RP:SCP|360->444|1ntcA|2e-15|27.1|85/91|a.4.1.12 :============================================================:BL:SWS|10->444|DCTD_RHIME|e-109|48.2|434/460 :$$$$$$$$$$$$$$ :RP:PFM|148->314|PF00158|8e-54|62.3|167/168|Sigma54_activat 361: . . . * . .: 420 :WPGNVRELRNAADRLVLGVPEGGHAGGKADPVDESTPLRERMERYERAVIADTLARTGGA:Sequence :HHHHHHHHHHHHcccccHHTcHHcTTcccHHHHHTccccccEEccEEEccHHHHTTcccc:Sec Str :########## :PROS|361->370|PS00688|SIGMA54_INTERACT_3|PDOC00579| :============================================================:RP:SCP|360->444|1ntcA|2e-15|27.1|85/91|a.4.1.12 :============================================================:BL:SWS|10->444|DCTD_RHIME|e-109|48.2|434/460 : $$$$$$$$$$$$$$$$$$$:RP:PFM|402->442|PF02954|2e-07|51.2|41/42|HTH_8 421: . . + . . .: 480 :VSQAADLLQVGKATLYDKIKRYGL :Sequence :cccccccEEEEccHHHHHHHHHHc :Sec Str :======================== :RP:SCP|360->444|1ntcA|2e-15|27.1|85/91|a.4.1.12 :======================== :BL:SWS|10->444|DCTD_RHIME|e-109|48.2|434/460 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|402->442|PF02954|2e-07|51.2|41/42|HTH_8