[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07164.1"

            "response regulator receiver (CheY-like) and ANTAR domain protein"
            ""

OrgPattern -------------------------------------------------------------------- ----1---------11111-111111111111111111111111111111111111111111-11111111-----------------------------------------------------------------33322---21------------------------------------------11-------------------------------1---------1----------------1----1-----------------------------------------------------------1----------1-1------------1-------1------22--122--1-1-----1---11111-----11111--111-11------------1111111111--1111111111111212-111----1--11111111----1----------------------------------111-----11111111111111111111-11111111--1111211111212111-11111-------------1----------------1-111111-----------------------------------------1-1-------------------------1----------11------------------------------------11------------------------------------------------------11-11---------------1-111-1---1-11111-11111112111---------2-----------------1111-11----11----------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHRNQAPSMTRRHPPPSAVAPPATTSRSLRILLVRDPHEADPLNVETIRAGLAQAGFTEV:Sequence : ccEEEEccTTcccHHHHHHHHHHHHHTTcccE:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|11->28|rrhpppsavappattsrs : ===============================:RP:SCP|30->150|1m5tA|6e-07|18.1|116/123|c.23.1.1 61: . . . * . .: 120 :QTVDADLRLPDTITASQPDLVIIASESAARDTIEHVCVSTQHAPRPIVLFTDNDDAQRIK:Sequence :EEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcTTccEEEEEccccHHHHH:Sec Str :============================================================:RP:SCP|30->150|1m5tA|6e-07|18.1|116/123|c.23.1.1 : ============================================:BL:SWS|77->218|PDTAR_MYCTU|1e-14|31.0|142/205 121: . . + . . .: 180 :AALSAGITAYIVDGLRAERVKTVLDVAYARFQLDQQLRAELDATKLKLAERKTVERAKGL:Sequence :HHHHTTccEEEEccccHHHHHHHHHHHHHHHTcHHTTccHcccHHHHHHHHHHHHHHHHH:Sec Str :============================== :RP:SCP|30->150|1m5tA|6e-07|18.1|116/123|c.23.1.1 :============================================================:BL:SWS|77->218|PDTAR_MYCTU|1e-14|31.0|142/205 : $$$$$$$$$$$$$$$$$$$:RP:PFM|162->215|PF03861|2e-08|44.4|54/56|ANTAR 181: . * . . . .: 240 :LMQARGISEDEAFKRLRSMAMERGIRLVDAAQRVIDVMA :Sequence :HHHHHcccHHHHHHHHHHHHHHHTccHHHHHHHHHHHH :Sec Str :====================================== :BL:SWS|77->218|PDTAR_MYCTU|1e-14|31.0|142/205 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|162->215|PF03861|2e-08|44.4|54/56|ANTAR