[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF07164.1 rmet0 ABF07164.1 "response regulator receiver (CheY-like) and ANTAR domain protein"
MHRNQAPSMTRRHPPPSAVAPPATTSRSLRILLVRDPHEADPLNVETIRAGLAQAGFTEV
QTVDADLRLPDTITASQPDLVIIASESAARDTIEHVCVSTQHAPRPIVLFTDNDDAQRIK
AALSAGITAYIVDGLRAERVKTVLDVAYARFQLDQQLRAELDATKLKLAERKTVERAKGL
LMQARGISEDEAFKRLRSMAMERGIRLVDAAQRVIDVMA
//