[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07169.1"

            "peptidase M16-like protein"
            ""

OrgPattern -------------------------------------------------------------------- 238-2----------11----11111------11111111112111--111-111-1---231-1111122-----------1211112231-1111--112-3311422-----------------1---1-1211--22---2232222221122------22233342-------------2-11---11111111111-11111111111111111111-1---1-111----------------------1------------------------------------------------------------------------1111111111-------------1--1-11111----111---1-4112332-----213231222222211121122112-21311111112-1---11111-1123211122121122222222222122212321222222222--11111111111112222-2121111111------------------------122211111-11111111111121111-1-------11211131---1-----11--424222223443462121111111111111111111111111--22-2---111-2222222222222122222---1111--------------------------------------------------------------------------------------------211111111111------------------------11111-1111111112221111111111111111-11111111111111--1-1---11111-2-221111-------------------------------------1--------121 -------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------111------1---1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSLSVMTIASPRLLRRLAGAAFGAAALLAGAVAHAAIPIESWTASTGAKVFFVPSPSIPM:Sequence : EcEEEEcccccEEEEEEcccccc:Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXX :SEG|12->36|rllrrlagaafgaaallagavahaa : =======================:RP:SCP|38->263|1bccA1|2e-25|17.1|217/229|d.185.1.1 61: . . . * . .: 120 :LDVNIDFDAGSRYDPPGKAGLATLTAALLDKGASAQDGQPARNEAQIADAFADTGADFGG:Sequence :EEEEEEEccccTTccTTTTTHHHHHHHHHccccGccccccHHHHHHHHHTTTcEEEEEEc:Sec Str : XXXXXXXXXXXXXXXXX :SEG|77->93|gkaglatltaalldkga : XXXXXXXXXXXXXX:SEG|107->134|iadafadtgadfggaaggdrggiglrtl :============================================================:RP:SCP|38->263|1bccA1|2e-25|17.1|217/229|d.185.1.1 121: . . + . . .: 180 :AAGGDRGGIGLRTLTASPEREQSLRLAAQLIKSPTYPDAVVAREKQRLITAIREGDTRPG:Sequence :cccEEEEEEEEEEEEccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHTcHH:Sec Str :XXXXXXXXXXXXXX :SEG|107->134|iadafadtgadfggaaggdrggiglrtl :============================================================:RP:SCP|38->263|1bccA1|2e-25|17.1|217/229|d.185.1.1 : =========================================:BL:SWS|140->452|Y4WB_RHISN|1e-29|27.6|308/447 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|141->198|PF00675|1e-05|32.8|58/145|Peptidase_M16 181: . * . . . .: 240 :VIADKKLSKAIYPNHPYGVSATAETVGSITHDDLVKFWQDNYTAKRAVVTLIGAIDRKQA:Sequence :HHHHHHHHHHHTTTcGGGccccHHHHHHccHHHHHHHHHHHccGGGEEEEEEEcccHHHH:Sec Str :============================================================:RP:SCP|38->263|1bccA1|2e-25|17.1|217/229|d.185.1.1 :============================================================:BL:SWS|140->452|Y4WB_RHISN|1e-29|27.6|308/447 :$$$$$$$$$$$$$$$$$$ :RP:PFM|141->198|PF00675|1e-05|32.8|58/145|Peptidase_M16 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|208->383|PF05193|5e-14|29.7|172/180|Peptidase_M16_C 241: + . . . . *: 300 :EQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPHPAQQASVALGQPAIARGDPDYFPL:Sequence :HHHHHHHcccccccHHHHcccccccccccccEEEEETcccEEEEEEEEEccTTcGGGTHH:Sec Str : X:SEG|300->311|llvgnyvlgggg :======================= :RP:SCP|38->263|1bccA1|2e-25|17.1|217/229|d.185.1.1 : ===============================:RP:SCP|270->454|1hr6A2|5e-36|13.5|185/237|d.185.1.1 :============================================================:BL:SWS|140->452|Y4WB_RHISN|1e-29|27.6|308/447 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|208->383|PF05193|5e-14|29.7|172/180|Peptidase_M16_C 301: . . . . + .: 360 :LVGNYVLGGGGFSSRLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTKKENTNEALAL:Sequence :HHHHHHHcEEEccccHHHHHHHHTTcccEEEEEEEEccccEEEEEEEEEcTTTHHHHHHH:Sec Str :XXXXXXXXXXX :SEG|300->311|llvgnyvlgggg :============================================================:RP:SCP|270->454|1hr6A2|5e-36|13.5|185/237|d.185.1.1 :============================================================:BL:SWS|140->452|Y4WB_RHISN|1e-29|27.6|308/447 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|208->383|PF05193|5e-14|29.7|172/180|Peptidase_M16_C 361: . . . * . .: 420 :VREIVAKYVAEGPTDAELRAAKDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWT:Sequence :HHHHHHHHHHHcccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHcccccHHHHH:Sec Str :============================================================:RP:SCP|270->454|1hr6A2|5e-36|13.5|185/237|d.185.1.1 :============================================================:BL:SWS|140->452|Y4WB_RHISN|1e-29|27.6|308/447 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|208->383|PF05193|5e-14|29.7|172/180|Peptidase_M16_C 421: . . + . . .: 480 :SQINKVTREQVRAAFQRHVHPDAMATVIVGGPEK :Sequence :HHHHcccHHHHHHHHHHHcTTccccEEEEEccTT :Sec Str :================================== :RP:SCP|270->454|1hr6A2|5e-36|13.5|185/237|d.185.1.1 :================================ :BL:SWS|140->452|Y4WB_RHISN|1e-29|27.6|308/447