[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF07169.1 rmet0 ABF07169.1 "peptidase M16-like protein"
MSLSVMTIASPRLLRRLAGAAFGAAALLAGAVAHAAIPIESWTASTGAKVFFVPSPSIPM
LDVNIDFDAGSRYDPPGKAGLATLTAALLDKGASAQDGQPARNEAQIADAFADTGADFGG
AAGGDRGGIGLRTLTASPEREQSLRLAAQLIKSPTYPDAVVAREKQRLITAIREGDTRPG
VIADKKLSKAIYPNHPYGVSATAETVGSITHDDLVKFWQDNYTAKRAVVTLIGAIDRKQA
EQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPHPAQQASVALGQPAIARGDPDYFPL
LVGNYVLGGGGFSSRLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTKKENTNEALAL
VREIVAKYVAEGPTDAELRAAKDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWT
SQINKVTREQVRAAFQRHVHPDAMATVIVGGPEK
//