[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07569.1"

            "Smr protein/MutS2"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1-------------------1-------11-------------11--------------------------1-11------111111111111111111111111111111111--1111111111111-1111111111111111111111-1---1111111111111-1111111111-11-------------------------11221211112112322212222221222221---111111-11122222222222222122-222222222222222222222211111222222222222222222221122--111111111111--1111111222211121111-1111111111111111111111111111111111111111---------11222222222222211111111111111-1-1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSHGAKPTSKPPHRMGLHDLATVRDGLKADAERREAERQAAEAAARRAEEEANVFRTSIG:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXX :SEG|31->52|aerreaerqaaeaaarraeeea : ========:BL:SWS|53->222|Y2166_ALISL|4e-21|35.8|162/177 61: . . . * . .: 120 :QVSNLRDRNRVEHPVKKPNPEPVQTRLNDKAVLEASLSDEFDVENLLDVDETMSFRRPGI:Sequence : :Sec Str :============================================================:BL:SWS|53->222|Y2166_ALISL|4e-21|35.8|162/177 121: . . + . . .: 180 :GEDVIKKLRRGEWVPQDKVDLHGLRSDEAREALANFLRRSVRNGVRCVRVIHGKGIGSPD:Sequence : ccccccccEEEcTTccHHHHHHHHHHHHHHHHTTcccEEEEEccccGGGTT:Sec Str : =============================================:RP:SCP|136->220|2d9iA1|8e-21|34.6|78/83|d.68.8.1 :============================================================:BL:SWS|53->222|Y2166_ALISL|4e-21|35.8|162/177 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|139->219|PF01713|5e-14|50.6|79/83|Smr 181: . * . . . .: 240 :KLPVLKGKVRSWLVQKEEVIAFVQARESQGGAGALMVLLRQPKT :Sequence :cTTcHHHHHHHHHHHTTTEEEEETccEEcccTTcEEEEccccc :Sec Str :======================================== :RP:SCP|136->220|2d9iA1|8e-21|34.6|78/83|d.68.8.1 :========================================== :BL:SWS|53->222|Y2166_ALISL|4e-21|35.8|162/177 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|139->219|PF01713|5e-14|50.6|79/83|Smr