[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF07569.1 rmet0 ABF07569.1 "Smr protein/MutS2"
MSHGAKPTSKPPHRMGLHDLATVRDGLKADAERREAERQAAEAAARRAEEEANVFRTSIG
QVSNLRDRNRVEHPVKKPNPEPVQTRLNDKAVLEASLSDEFDVENLLDVDETMSFRRPGI
GEDVIKKLRRGEWVPQDKVDLHGLRSDEAREALANFLRRSVRNGVRCVRVIHGKGIGSPD
KLPVLKGKVRSWLVQKEEVIAFVQARESQGGAGALMVLLRQPKT
//