[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07698.1"

            "peptidylprolyl isomerase, FKBP-type"
            ""

OrgPattern ----------------------------------------------1--------------------- -12-21111111111------1--11-----1111121111212222221-22222221122212-122322222222111-------33331333---124332253-1111111111111111---11------11111---2-1211221111111111111111111111111111111111----2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-32221------111111-11111------------111111111------1----------111-------------------111--1------------------------------1-12-1-----1111112----11221111-11122222-12222222222212-11111213211222221111122-3221---------52223233-222243-----------------------1-----332212313335455444555554554566--11--2-1-11122222222222222222-2222222222222222222222222222222222222222222211221212-222222212222--121111111111111221222211111222233333231113344344434444443444---------23333333333333322222222221111111-221111---1-11111---------------------------1--------14- 1111574194454564445544454421243332223444344323333333332333434432323313442334433433332233-35343543233333555-6r8CGOEDHA75779C6IG4J8b*F1GCK5878J5CED7A857C65D8DBCC77868974658768865EBD*A8869EFKN5HFEF9CAAW -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQTTPSGLQFEDTVVGSGDEAKAGKHVTVHYTGWLFENGQAGRKFDSSKDRNDPFVFPLG:Sequence :EccccccccccccccEEEcccccEEEEccccccccccccccTTccccccTTccTTccccc:Sec Str :============================================================:RP:SCP|1->115|1fd9A|9e-32|40.4|109/204|d.26.1.1 : ======================================================:BL:SWS|7->115|FKBP_NEIMB|5e-35|64.8|105/109 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->113|PF00254|3e-20|58.0|88/91|FKBP_C 61: . . . * . .: 120 :AGHVIRGWDEGVQGMKVGGTRRLVIPADLGYGARGAGGVIPPNATLLFEVELLAV :Sequence :cccccTTccccccEEEEccHHHHTTcGGGGccccccccEEEEcccccccEEEEEE :Sec Str :======================================================= :RP:SCP|1->115|1fd9A|9e-32|40.4|109/204|d.26.1.1 :======================================================= :BL:SWS|7->115|FKBP_NEIMB|5e-35|64.8|105/109 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|22->113|PF00254|3e-20|58.0|88/91|FKBP_C