[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07717.1"

            "alanyl-tRNA synthetase"
SYA_RALME   "RecName: Full=Alanyl-tRNA synthetase;         EC=6.1.1.7;AltName: Full=Alanine--tRNA ligase;         Short=AlaRS;"

OrgPattern 11111111111111111111111121112211111111111111111121222111222211111-11 2111111111111111111-1111111111111111111111111111111111111111111111112211-111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111222221121111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111112111111111111121111111111111111111111111112111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111-1111111111111111111111111222222111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111-111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 1111241-31111111111-111111211111111111111111111111111111111111111111-2111111111111111111-12111111111111222123133332632221222242223F212222222221221222122223322122222332322322122222I2221222451212223222 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPRRRLRPHNMKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFL:Sequence : cccEcHHHHHHHHHHHHHHHHHHTcccEEEEcTTcccTTccccccccccHHHHHHHHH:Sec Str : ===================================================:RP:SCP|10->261|1riqA2|e-130|63.1|236/236|d.104.1.1 : ==================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->555|PF01411|0.0|62.3|523/546|tRNA-synt_2c 61: . . . * . .: 120 :GTDKRPYVRATSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAW:Sequence :HHHHHccTTcTTHHHHHTTHcTcccccccccccccccEEETEEEEEcHHHHHHHHTTcEE:Sec Str :============================================================:RP:SCP|10->261|1riqA2|e-130|63.1|236/236|d.104.1.1 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->555|PF01411|0.0|62.3|523/546|tRNA-synt_2c 121: . . + . . .: 180 :ELLTKVYQLPADKLWVTVYAEDDEAYDIWAKEVGVPADRIVRIGDNKGARYASDNFWQMA:Sequence :EEGGGccHHHHHHHHHHHHHTEEEHHHHHHHHHHHHHHHcccEEEEHHHHHHTcTTTTTc:Sec Str :============================================================:RP:SCP|10->261|1riqA2|e-130|63.1|236/236|d.104.1.1 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->555|PF01411|0.0|62.3|523/546|tRNA-synt_2c 181: . * . . . .: 240 :DTGPCGPCSEIFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDEQGTMTPLPKPC:Sequence :ccccccTTccccccccTTEccccccccEEcHHHHHHHHHHHHHHHHHHHHHcccccHHHH:Sec Str : XXXXXXXXXXXX :SEG|201->212|ggppgspeedgd :============================================================:RP:SCP|10->261|1riqA2|e-130|63.1|236/236|d.104.1.1 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->555|PF01411|0.0|62.3|523/546|tRNA-synt_2c 241: + . . . . *: 300 :VDTGMGLERIAAVLQHVHSNYEIDLFQALIKGAGRETHIADLNQNSLKVIADHIRACSFL:Sequence :cccEEEEEcHHHHHHHTTccTTcHHHHHHHHHHHHHHHHHHcccTTcTTcGGGGTccTGG:Sec Str :===================== :RP:SCP|10->261|1riqA2|e-130|63.1|236/236|d.104.1.1 : =======================================:RP:SCP|262->472|1riqA1|7e-69|41.3|208/212|a.203.1.1 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->555|PF01411|0.0|62.3|523/546|tRNA-synt_2c 301: . . . . + .: 360 :IVDGVIPGNEGRGYVLRRIVRRAIRHGYKLGQKTPFFHKLVGDLVAQMGEAYPELAEAQS:Sequence :GGTccccccccHHHHHHHHHHHcccccccccccccTTHHHHTTccccccccccHHHHTcE:Sec Str :============================================================:RP:SCP|262->472|1riqA1|7e-69|41.3|208/212|a.203.1.1 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->555|PF01411|0.0|62.3|523/546|tRNA-synt_2c 361: . . . * . .: 420 :RVVEVLKAEEERFFETIENGMSILDAAVADLKAKGGKVLDGELAFKLHDTFGFPLDLTQD:Sequence :EcccEEcHHHHHHHHHTTcccHHHHHHHHHTTTTTcTTccHHHHHHTccTTcccHHHHHH:Sec Str :============================================================:RP:SCP|262->472|1riqA1|7e-69|41.3|208/212|a.203.1.1 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->555|PF01411|0.0|62.3|523/546|tRNA-synt_2c 421: . . + . . .: 480 :VAREQEITVDEAAFDAAMTRQREQARAAGKFKMAAGLEYSGEKTVFHGYDALSMDGVRVT:Sequence :HHHHHHTTccccccccccHHHHHHHHHHHHHTccEEEccEEEcccccTTccTTccEEEEE:Sec Str :==================================================== :RP:SCP|262->472|1riqA1|7e-69|41.3|208/212|a.203.1.1 : ==================:RP:SCP|463->555|2e1bA1|1e-14|26.0|77/87|b.43.3.6 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->555|PF01411|0.0|62.3|523/546|tRNA-synt_2c 481: . * . . . .: 540 :ALYVDGASVDTMQPGQSGVVVLDNTPFYAESGGQVGDQGTLVSGPAVFAVADTTKIQSDV:Sequence :EEETTE EEEcccccccccccccccccccccTTcccccEEETETTETEEEEEEEccTTcc:Sec Str :============================================================:RP:SCP|463->555|2e1bA1|1e-14|26.0|77/87|b.43.3.6 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->555|PF01411|0.0|62.3|523/546|tRNA-synt_2c 541: + . . . . *: 600 :FGHQGTLANGALKVGDTVAAQVDAVRRARTVRNHSATHLMHKALREVLGTHVQQKGSLVD:Sequence :cEEEEEccGGGccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEcccc:Sec Str : XXXXXXXXXXXXXXXXX :SEG|556->572|dtvaaqvdavrrartvr :=============== :RP:SCP|463->555|2e1bA1|1e-14|26.0|77/87|b.43.3.6 : ============================:RP:SCP|573->707|1v4pA|1e-37|27.4|135/151|d.67.1.2 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 :$$$$$$$$$$$$$$$ :RP:PFM|15->555|PF01411|0.0|62.3|523/546|tRNA-synt_2c 601: . . . . + .: 660 :PDKTRFDFSHNAPLTDAQIRQIEEIVNAEILSNAPTVAQVMPFDDAVKSGAMALFGEKYA:Sequence :ccccccEEEEEEEccccTTHHHHTTcccccTcccccccccccccccccEEcccccTTTcT:Sec Str :============================================================:RP:SCP|573->707|1v4pA|1e-37|27.4|135/151|d.67.1.2 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 661: . . . * . .: 720 :DDVRVLSIGTSKELCGGTHVTRTGDIGLFKIVVEAGVAAGIRRVEAITGDNALHYLQSLD:Sequence :THHHHHTccccccccccTTEEEEEEcccEEEEEEccEETTEEEEEEccHHHH HHHHHHH:Sec Str :=============================================== :RP:SCP|573->707|1v4pA|1e-37|27.4|135/151|d.67.1.2 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|663->704|PF07973|1e-07|54.8|42/44|tRNA_SAD 721: . . + . . .: 780 :ARLNEAAAALRAQPSELVPRIGQVQDQVRALEKELEKLKSKLASSQGDELAAQAVDVKGL:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :XXXXXXXXXXXX :SEG|721->732|arlneaaaalra : XXXXXXXXXXXXXXXX :SEG|750->765|alekeleklksklass : ==========:RP:SCP|771->840|1jrmA|2e-10|14.9|67/104|d.206.1.1 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 781: . * . . . .: 840 :KVLAAQLDGADVKTLRETMDKLKDKLQSAAIVLAAVADGKVSLIAGVTADATSKVKAGEL:Sequence :HHHHHHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEETTE:Sec Str :============================================================:RP:SCP|771->840|1jrmA|2e-10|14.9|67/104|d.206.1.1 :============================================================:BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|808->878|PF02272|1e-06|41.8|67/67|DHHA1 841: + . . . . *: 900 :VNFVAQQVGGKGGGRPDMAQAGGTDPANLPKALAGVTEWVSAKV :Sequence :EEEcccccccccccccccccccccTTHHHHHHHHHHHHHHHH :Sec Str :============================================ :BL:SWS|11->884|SYA_RALME|0.0|100.0|874/874 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|808->878|PF02272|1e-06|41.8|67/67|DHHA1