[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07787.1"

            "transcriptional regulator, TetR family"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------1-----------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11------------1-------------------1---1-1---------------------------------1-------1111111111111111111111111111--11111111-1112---1----211111111------1-------------------1--------------------------------1-1---22-12-1--1-1111111111111111121-------------11---1-------------------------------111---------------------------------------------------------12-----------------1111111-----22222222222221221----------11121111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEAKPQAGPRRTRDRILDVSLRLFNELGEPNVTTTTIAEAMEISPGNLYYHFRNKDDIIN:Sequence : ccccccHcccHHHHHHHHHHHHHHHcGGGccHHHHHHHHTccHHHHHHHHccHHHHHH:Sec Str : ===================================================:RP:SCP|10->75|3c07A1|2e-16|33.3|66/75|a.4.1.9 :============================================================:BL:SWS|1->86|ACRR_SHIFL|6e-10|36.0|86/215 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->62|PF00440|2e-05|38.3|47/47|TetR_N 61: . . . * . .: 120 :SIFVRFEQEMERRLKMPEDHKATLGESWGYLQYMSEFLWNYRFLYRDINDLLARNRMLET:Sequence :HHHHHHGGGcccccccTTcHHHHHHHHHHHHHHHHHHHHHcTTHHHccccHHTTcccccH:Sec Str :=============== :RP:SCP|10->75|3c07A1|2e-16|33.3|66/75|a.4.1.9 :========================== :BL:SWS|1->86|ACRR_SHIFL|6e-10|36.0|86/215 :$$ :RP:PFM|16->62|PF00440|2e-05|38.3|47/47|TetR_N 121: . . + . . .: 180 :NFKRIVDQKKRFALEICRQFQEDGDMDATPEQVDAICTNIVVIATYWLSFQFVQHPRQYN:Sequence :HHHHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHH:Sec Str 181: . * . . . .: 240 :DPEQIRGYLHGSSYHIFSILAPYLRGKAREAFDQLAREYAAEKAAADAAKLEKDRK :Sequence :HHTccTTTcHTTcHHHHHTHHHHHcccHHHHHHH :Sec Str : XXXXXXXXXXXXXXXXXXXXX :SEG|215->235|lareyaaekaaadaaklekdr