[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07796.1"

            "sigma-24 (FecI-like)"
            ""

OrgPattern -------------------------------------------------------------------- --1-7------------------------------------222--------------------111--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111-1211--------111112-------------------111-------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------1111111----------------------------------------------1111111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MATDQELSDFLASVERRAFKQAVFAVRDDEAALDIVQDAMIKLAEKYGDKSAAELPPLFQ:Sequence : HHHHHHHHHHTTcHHHHHHHHHHccccccHHHHHHHHHHHHHHcccTTccccHHHHHH:Sec Str : ========================================================:RP:SCP|5->81|1z77A2|2e-05|13.0|77/125|a.121.1.1 : =======================================================:BL:SWS|6->168|RPOE_STRAW|9e-09|28.7|136/179 61: . . . * . .: 120 :RILQNTIHDWFRRQKVRNTWVTLFSNLRDEREGDDSDLLDTLEAQAGTEMAESSADKVER:Sequence :HHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHH ccccccccHHcc:Sec Str :===================== :RP:SCP|5->81|1z77A2|2e-05|13.0|77/125|a.121.1.1 : =============================:RP:SCP|92->188|1iw7F2|3e-10|16.3|92/100|a.4.13.2 :============================================================:BL:SWS|6->168|RPOE_STRAW|9e-09|28.7|136/179 121: . . + . . .: 180 :AQVMHIIEQEIQRLPTRQREAFLMRYWEDMDVAETAAVMGCSEGSVKTHCSRATHTLAQA:Sequence :cccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHH:Sec Str :============================================================:RP:SCP|92->188|1iw7F2|3e-10|16.3|92/100|a.4.13.2 :================================================ :BL:SWS|6->168|RPOE_STRAW|9e-09|28.7|136/179 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|129->177|PF08281|7e-07|42.9|49/54|Sigma70_r4_2 181: . * . . . .: 240 :LRARGVRL :Sequence :Hcc :Sec Str :======== :RP:SCP|92->188|1iw7F2|3e-10|16.3|92/100|a.4.13.2