[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07810.1"

            "Alcohol dehydrogenase, zinc-binding"
            ""

OrgPattern ------1244444543-311-21-31112123------------------21--111-----111-33 3882K223553131B88BB-B855KJBBBBBC89895ALJ2847A3313432453314--8633D6HEF841---111---3811111-------------4-3-E-421--------------------1---2-12245---B-74241121111------1-162565------------23243---5158888897826878684523-2767332357744444355-22222222222222432232-5-33-1--19711447224311---------122--------1---------------111---1111-2--2-----------1-----------1--------------1111--24-8D66511111B5D99226A799734444342444-7A987A686GB1CBB4889BCFEBAD485452434442744444444366-5433--1111111111-------------111124964227569ABCCDDB666677AC666547G7J9NHB-245355443979595256-22152-------113523211---1--1-111-3322323134466FE-11------------------------11212731447221222225-22212213133---1511------4114-231112122111-11111-111111111111168542333111111111111111161112221--222222222222----11-112222145881112---------1122534241324279676BFC988AB5A98-----1----11-411111211113445655354-------1772244-----------------11--1-----------------1------341 --42Lh3-851-349BNQERFMNikePAA78CAGGAAB9B8CC967QKLlUVreHJNGDA99A55221-1243121221212243245-MdGNEKAB9A57269D8-897O8A8976655537776595Il81B984355947B42755593396A8799B72E871558C327F3234X2136HHBLDL7I33VIHK3 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKAIEIREYGAPEVLQETQRPDPEPKAGEILIRVAAAGINRPDVFQRTGNYPVPPGASDL:Sequence :EEEEEEcccccGGGEEEEEEEcccccTTcEEEEEEEEEccTHHHHHTTTccTTccTTTTc:Sec Str : ======================================= :RP:SCP|9->47|2ck3H2|1e-09|12.8|39/44|b.93.1.1 : ===================:RP:SCP|42->269|1ztpA1|4e-34|11.6|207/228|d.86.1.2 :============================================================:BL:SWS|1->332|QORX_HUMAN|3e-59|39.5|324/332 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->89|PF08240|2e-05|51.7|58/108|ADH_N 61: . . . * . .: 120 :PGLEVAGVVVGGDLSHPANRFGLKAGDRVCALVQGGGYAELCTAPIEQCLPVPEGLTDIE:Sequence :cccEEEEEEEEccTEEcTTccTTcEEEEcccccccEEEEccTTEEEccTTccTTccGGGG:Sec Str :============================================================:RP:SCP|42->269|1ztpA1|4e-34|11.6|207/228|d.86.1.2 :============================================================:BL:SWS|1->332|QORX_HUMAN|3e-59|39.5|324/332 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|27->89|PF08240|2e-05|51.7|58/108|ADH_N 121: . . + . . .: 180 :AAALPETFFTVWSNVFDRGQLGKGPRGAAETLLIQGGSSGIGTTAIQIAKALGFKVFVTA:Sequence :GTTTcHHHHHHHHHHHTTTccccccEccTTEEEEccTTcHHHHHHHHHHHHTTcEEEEEE:Sec Str :============================================================:RP:SCP|42->269|1ztpA1|4e-34|11.6|207/228|d.86.1.2 :============================================================:BL:SWS|1->332|QORX_HUMAN|3e-59|39.5|324/332 : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|160->276|PF00107|4e-21|46.2|117/128|ADH_zinc_N 181: . * . . . .: 240 :GSDDKCKACESLGADRAINYKTQDFVAEVKALTEGKGVDVILDMVAGSYLARELSCIADD:Sequence :ccHHHHHHHHHTTccEEEETTccccHHHHHHHHcTTcEEEEEEcccHHHHHHHHTTEEEE:Sec Str :============================================================:RP:SCP|42->269|1ztpA1|4e-34|11.6|207/228|d.86.1.2 :============================================================:BL:SWS|1->332|QORX_HUMAN|3e-59|39.5|324/332 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|160->276|PF00107|4e-21|46.2|117/128|ADH_zinc_N 241: + . . . . *: 300 :GRIVIIALLGGGKAEIPLGDILRRRITITGSTLRPRPASFKGAIAQALHQNVWPLLASGK:Sequence :EEEEEcccGGGTcccccHHHHHHTTcEEEEccGGGccTHHHHHHHHHHHHHHHHHHHTTc:Sec Str :============================= :RP:SCP|42->269|1ztpA1|4e-34|11.6|207/228|d.86.1.2 :============================================================:BL:SWS|1->332|QORX_HUMAN|3e-59|39.5|324/332 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|160->276|PF00107|4e-21|46.2|117/128|ADH_zinc_N 301: . . . . + .: 360 :IKPVIHKVFPAAQAADAHRLMESSEHIGKIVLTW :Sequence :ccccEEEEEcGGGHHHHHHHHHTTccccEEEEEc :Sec Str :================================ :BL:SWS|1->332|QORX_HUMAN|3e-59|39.5|324/332