[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07859.1"

            "Enoyl-CoA hydratase / short chain enoyl-CoA hydratase"
            ""

OrgPattern 22-1--4987988975-121211942231248-----------------------------2421-11 2344C325113543JZMBB-BN44PcCBCCCMUQVQHQio2Q3N112511125444341199I19DJD7B6--------1519-----1111-1211--31222254323--------------11111121112155555---4821121111111111111111-112111111111111153423---8566666655657575553866457755BA85421111119-111111111111111111111-1----1-----11---1-111111---11111111111111111111111111111111111111111--1231111111212-2221221-211-3-11-561427-15---1--2-3-1EBBK-----41TIM434PHPKE67766675777-22922G4A8CO-7441559978B98A8F88AB368899G--------411-1EC5-----------------------------1CHTC-4aRERCHIGPC98887EECDAAA959KDWLbgX23DD9989BBHAHHKR228----65----------H795UAA1---------16762E13--3534C632---------------------------671572948536666656A666686A7679---2-1-------42442236445654577-476764466645455655644422333454444444444444453434444--333333333333---3232223333-6813222111111111111EEDBE6A68651B99B7A89697A88555----------222622222363443333333333-------1665565-----------------------------------------------11 ----565-322-437A8749888D7C98966468766A67777878676899ED775454233111-------1------111-11-1-5B387662321327667-9B5GKGAEDB74669B4KB5E4V*J-SAH4385B68FA38962A65D67AAGDH88IA8385AGAA893332U3545499BF687779676A -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTAQLLSERVDSTLVLTISNPEARNALHPDIYAASAEALEVAARDDSIRAVILTGADGVF:Sequence :ccccEEEEEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHcTTccEEEEEEccccc:Sec Str : XXXXXXXXXXX :SEG|33->43|aasaealevaa : ========================================================:RP:SCP|5->256|1dciA|7e-52|25.4|252/275|c.14.1.3 : ========================================================:BL:SWS|5->259|ECHH_RHIME|1e-31|32.4|250/257 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->185|PF00378|1e-23|35.9|167/170|ECH 61: . . . * . .: 120 :CAGGNLNRLLGNRSQPPSVQADSIEVLNQWIESFHAFPKPIIAAVEGPAAGAGFSLVLAC:Sequence :ccccccccHHHcHHHHHHHHHHHHHTHHHHHHHHHHccccEEEEEccEEETHHHHHHHHc:Sec Str : ###################:PROS|102->122|PS00166|ENOYL_COA_HYDRATASE|PDOC00150| :============================================================:RP:SCP|5->256|1dciA|7e-52|25.4|252/275|c.14.1.3 :============================================================:BL:SWS|5->259|ECHH_RHIME|1e-31|32.4|250/257 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->185|PF00378|1e-23|35.9|167/170|ECH 121: . . + . . .: 180 :DFVVAASDAKFVMAYVKVGLTPDGGGSYEIARMLPRQLASEIMMEGKPVDPARLAHFGIV:Sequence :cEEEEETTcEEEccGGGGTccccTTHHHHHHHHHcHHHHHHHHHHcccEEHHHHHHHTcc:Sec Str :## :PROS|102->122|PS00166|ENOYL_COA_HYDRATASE|PDOC00150| :============================================================:RP:SCP|5->256|1dciA|7e-52|25.4|252/275|c.14.1.3 :============================================================:BL:SWS|5->259|ECHH_RHIME|1e-31|32.4|250/257 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->185|PF00378|1e-23|35.9|167/170|ECH 181: . * . . . .: 240 :NRVAAPGQALTEALRIAENLAKESPNAVSGIKSLINHAGTATLTEHLAAERDSFVAALHH:Sequence :cEEEcGGGHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHc:Sec Str :============================================================:RP:SCP|5->256|1dciA|7e-52|25.4|252/275|c.14.1.3 :============================================================:BL:SWS|5->259|ECHH_RHIME|1e-31|32.4|250/257 :$$$$$ :RP:PFM|16->185|PF00378|1e-23|35.9|167/170|ECH 241: + . . . . *: 300 :KDGGEGISAFLEKRKPNYR :Sequence :HHHHHHHHHHTTTcccccc :Sec Str :================ :RP:SCP|5->256|1dciA|7e-52|25.4|252/275|c.14.1.3 :=================== :BL:SWS|5->259|ECHH_RHIME|1e-31|32.4|250/257