[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07863.1"

            "Protein of unknown function DUF132"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111------11-------111111--111--1111-1-1-111------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHTTHTGHDANSSAGPDAGALSVTSAPRVVLDSNIWVDLLVFRDPHVEPIRAALAAGAIA:Sequence : cccccEEEEEEEEEEEEcHHHHHH HHHHHHHHHHHcccE:Sec Str : XXXXXXXXXXXX:SEG|49->65|piraalaagaiapvira : ===================================:RP:SCP|26->142|1v8oA|1e-04|15.9|107/132|c.120.1.1 61: . . . * . .: 120 :PVIRADCREELRRVLAYPQFTRFAVDIDAALAEVDRFTTLEPVPTQEDADAIRLPKCKDT:Sequence :EEEEHHHHHHHHHHHHcccHHHHHHHHHHHHHHHTTcTTEEEEcTTccEEcccTTccccc:Sec Str :XXXXX :SEG|49->65|piraalaagaiapvira :============================================================:RP:SCP|26->142|1v8oA|1e-04|15.9|107/132|c.120.1.1 121: . . + . . .: 180 :DDQKFIELAHFSRAALLVSKDKAVLKLRSRLRRSSGVEVLPPLAFGGWLAAWVPPDDRG :Sequence :HHHHHHHHHHHTccccGGGGcccEcHHHHHHHHHTTccEEcHHHHHHHH :Sec Str : XXXXXXXXXXX :SEG|145->155|lklrsrlrrss :====================== :RP:SCP|26->142|1v8oA|1e-04|15.9|107/132|c.120.1.1