[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF07863.1 rmet0 ABF07863.1 "Protein of unknown function DUF132"
MHTTHTGHDANSSAGPDAGALSVTSAPRVVLDSNIWVDLLVFRDPHVEPIRAALAAGAIA
PVIRADCREELRRVLAYPQFTRFAVDIDAALAEVDRFTTLEPVPTQEDADAIRLPKCKDT
DDQKFIELAHFSRAALLVSKDKAVLKLRSRLRRSSGVEVLPPLAFGGWLAAWVPPDDRG
//