[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF07889.1 rmet0 ABF07889.1 "hypothetical protein"
MDHFGASFGRFAMHKLPVVTLCLIAALSAMTVFICLSDTVAPRDTEYGSGKAVFKHYLVQ
YVR
//