[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07913.1"

            "iron-sulfur cluster assembly protein IscA"
            ""

OrgPattern ------------------------1--11-11----------------------------------11 121111111111-111111-11111111111111111111111111-1111111111111---1111---1-----------112111-----------1-1111111-1--------------1---------1-11111---11223333211111111111212433311111111111111111---111--------1------1-1111---1111-11------211111111111111-111111--------------------------------------------------------------------------------------------------1-----------------------1211121121232332223333222222222222-22222222232212223332222232222222333322222222222111-2213-1111111111122221221222221111211122222222222222222222112222222332221221113111113121111312122211111112222331-----------------------222221---------------------------222211112221222222222222222222222--122211----33232323333333333-333333333333322332333333333333333333333333333323333213333333333332212111111111322122222222222212221111111222312222222222222322222222222222222222222232222222222222222213-----------------------------------------------------32- 1-----1-1---2221111111111111112--111-11111111111111111-11-1111111111-1211111111111111111--211111111111-332-1213122321-22222232121362-214221121222121-121-1131212122211-114312311222S1111273551322221221 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFDSKAKMISMTEKAAKHVARYLERRGKGVGLRVGVKTTGCSGLAYKLEYVDEVLPEDQV:Sequence :cccccccccEEccHHHHHHHHHHHHHTccccEEEEccccccccccccEEEccccccccEE:Sec Str : XXXXXXXXXXXXXXXX :SEG|25->40|rrgkgvglrvgvkttg : ====================================================:RP:SCP|9->103|1r94A|1e-26|52.6|95/97|b.124.1.1 : ====================================================:BL:SWS|9->113|ISCA_XENNE|6e-32|69.5|105/107 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->99|PF01521|1e-15|39.6|91/92|Fe-S_biosyn 61: . . . * . .: 120 :FETHGIKVIVDPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV :Sequence :EEccccEEEEcHHHHHHHTTcEEEEEccccccEEEEEcHHHHccccccccccc :Sec Str : ################## :PROS|94->111|PS01152|HESB|PDOC00887| :=========================================== :RP:SCP|9->103|1r94A|1e-26|52.6|95/97|b.124.1.1 :===================================================== :BL:SWS|9->113|ISCA_XENNE|6e-32|69.5|105/107 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|9->99|PF01521|1e-15|39.6|91/92|Fe-S_biosyn