[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF07913.1 rmet0 ABF07913.1 "iron-sulfur cluster assembly protein IscA"
MFDSKAKMISMTEKAAKHVARYLERRGKGVGLRVGVKTTGCSGLAYKLEYVDEVLPEDQV
FETHGIKVIVDPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV
//