[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07921.1"

            "short-chain dehydrogenase/reductase SDR"
            ""

OrgPattern -------------------------------------------------------------------- --1-----------1---------------------------------------------------------------------------------------1---1--------------------------------------------------------------------------------------1111111111111111--1111111----1-1-------1----------------------------------------------------------------------------------------------------------------------------------------------1-----------1---------------------------------------------------1--1111-11---------------------------------------------------111111111111111111111111-11111111--1111-11111--1--------1------------1-1------------------------------------------------------------1-----------------------------1-11---------------------------------------------------------------------------------------------------1211------------------------------------------------------------------------------------------------------------------------------------------------1- ------------122-1---11------------------------------1---------111-1---22111121122222-211-11-1--111111------1-14---------1111--1-------11-----1--1-1------1---1-----1----------------------------11----- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTTGTPRSTHLYIVTGASRGLGAALVRALLVPGNRVIGVARSRNPELEAEATASGVRVAW:Sequence : cEEEEEEccHHHHHHHHHHHHHHTccE:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|16->33|gasrglgaalvrallvpg : ==========================:RP:SCP|35->244|1pwxA|1e-15|17.3|196/252|c.2.1.2 : =========================:BL:SWS|36->250|BZRD_BACCE|1e-31|37.1|213/249 : $$$$$$$$$$$$$$$:RP:PFM|46->178|PF00106|4e-06|33.6|128/169|adh_short 61: . . . * . .: 120 :HLQDLSQPGPSAGWLASVLDAVEEAPASITLILNAGVVEPIGPITQLHDSTLVPHLQTNL:Sequence :EEEEEccTTcHHHHHHHHHHHHHHHTcccEEEEcccccccccccccccHHHHHHHHHHHT:Sec Str :============================================================:RP:SCP|35->244|1pwxA|1e-15|17.3|196/252|c.2.1.2 :============================================================:BL:SWS|36->250|BZRD_BACCE|1e-31|37.1|213/249 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->178|PF00106|4e-06|33.6|128/169|adh_short 121: . . + . . .: 180 :VTPMTMTGAFIEHTVRFDCPRKVLAISSGAARNPVPGWSAYCAGKAGLDMFIRSVNTEYA:Sequence :HHHHHHHHHHHHHHHHHTcEEEEEEEEEGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|35->244|1pwxA|1e-15|17.3|196/252|c.2.1.2 :============================================================:BL:SWS|36->250|BZRD_BACCE|1e-31|37.1|213/249 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|46->178|PF00106|4e-06|33.6|128/169|adh_short 181: . * . . . .: 240 :SVPEPRTLRAVALAPGVVDTGMQETIRGADFAQVQRFRDLKDNEQLASPDDTARRIVAYL:Sequence :HHHTTcccEEEEEEEcccccHHHHHHHTTTcccHHHHHHHHHHHccccHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|35->244|1pwxA|1e-15|17.3|196/252|c.2.1.2 :============================================================:BL:SWS|36->250|BZRD_BACCE|1e-31|37.1|213/249 241: + . . . . *: 300 :ARPDFGTTELDDIRKY :Sequence :HccHHHEccHHHHH :Sec Str :==== :RP:SCP|35->244|1pwxA|1e-15|17.3|196/252|c.2.1.2 :========== :BL:SWS|36->250|BZRD_BACCE|1e-31|37.1|213/249