[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07939.1"

            "2-dehydro-3-deoxyphosphooctonate aldolase"
KDSA_RALEJ  "RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;         EC=2.5.1.55;AltName: Full=Phospho-2-dehydro-3-deoxyoctonate aldolase;AltName: Full=3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase;AltName: Full=KDO-8-phosphate synthetase;         Short=KDO 8-P synthase;         Short=KDOPS;"

OrgPattern ---1--1111111111-111111-------------------------------11-111-11----- 333-----------------------------------------------------------1-------1--------1111111111111-111---111111121-112222221122222111111111121222-1222422122221--11112-1111123332-1-----1----11122111211111112112111211111111111111111111111111111111111111111111111----------11----1---21------1111--------------1111111111111----------12112111111111132111111111-13--2111432521422221-22332111111111--1111111111111111111111-1111111111211111111111111111111111111111111111111111111------------1111111111111----1-11-111111211112111111121222222211111211111111111111111111112121111111---11123111111--1111123243333212213-34111111111111111111111111122111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111121111111111111111211111111111111111111112111121111121211111111111111112121111111211111111111111111113111111----------1---------------------------1--1-111111 ------------------------------------------------------------------------------------------------------------1------------------------------------------------------1---------11-----1--111113-41--1111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLCGFDVGLDKPFFLIAGPCVIESEQMALDTAGELKAITGELGIPFIYKSSFDKANRSS:Sequence :EEETTEEEcTTcccEEEEEEEEcccHHHHHHHHHHHHHHHHHHTccEEEEEEcccTTccc:Sec Str :============================================================:RP:SCP|1->275|1rzmA|2e-78|32.4|250/338|c.1.10.4 :============================================================:BL:SWS|1->289|KDSA_RALEJ|e-163|96.9|289/289 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->254|PF00793|4e-37|41.0|234/278|DAHP_synth_1 61: . . . * . .: 120 :GKSFRGLGMEKGLEILATVKRQIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFI:Sequence :ccccccccHHHHHHHHHHHHHHHccEEEEEcccGGGHHHHHTTccEEEEcGGGTTcHHHH:Sec Str :============================================================:RP:SCP|1->275|1rzmA|2e-78|32.4|250/338|c.1.10.4 :============================================================:BL:SWS|1->289|KDSA_RALEJ|e-163|96.9|289/289 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->254|PF00793|4e-37|41.0|234/278|DAHP_synth_1 121: . . + . . .: 180 :RACAQSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLPDDVFMACERGVSFGYNNLVS:Sequence :HHHHHTTcEEEEEccTTccGGGHHHHHHHHHHTHHHTTcTcccEEEEEccEEcccccEEc:Sec Str :============================================================:RP:SCP|1->275|1rzmA|2e-78|32.4|250/338|c.1.10.4 :============================================================:BL:SWS|1->289|KDSA_RALEJ|e-163|96.9|289/289 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->254|PF00793|4e-37|41.0|234/278|DAHP_synth_1 181: . * . . . .: 240 :DMRSLAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVATGVAGLFMETH:Sequence :cTHHHHHHHHHTccEEEEHHHGGEETTTTcccHTccGGGHHHHHHHHHHTcccEEEEEEE:Sec Str :============================================================:RP:SCP|1->275|1rzmA|2e-78|32.4|250/338|c.1.10.4 :============================================================:BL:SWS|1->289|KDSA_RALEJ|e-163|96.9|289/289 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->254|PF00793|4e-37|41.0|234/278|DAHP_synth_1 241: + . . . . *: 300 :PDPSKAMSDGPNAVPLSRMKELLTVLRDLDGMVKRAGFLEDNFGWPACA :Sequence :ccGGGccccGGGcEEGGGHHHHHHHHHHHHHHHHHccccc :Sec Str :=================================== :RP:SCP|1->275|1rzmA|2e-78|32.4|250/338|c.1.10.4 :================================================= :BL:SWS|1->289|KDSA_RALEJ|e-163|96.9|289/289 :$$$$$$$$$$$$$$ :RP:PFM|8->254|PF00793|4e-37|41.0|234/278|DAHP_synth_1