[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF07996.1"

            "Orn/DAP/Arg decarboxylase 2"
            ""

OrgPattern -----------------1-----11--111111111111111111111--11-----1----111--- 111-21-1---11121111-1111-211111-1---111112221-11-11----1-2--32--1114331--------12112121111111112-11111-1121111---------------111111111211111211111111111111111111111111112111-111111111211--111111111111111111111-111-11111111111111111211222222222222221111111--1111-1-111111-11111111-------11111111111111-------------111111111111-11111111111132112111-1---1211-1111--1111111---1111111122222211112121112211111111111-3313323122213333222222222211112211111211111111111111122---11111---------------------122321111111111211111111311111111221122-111211211-12211112211111111111123322212321112121223122112111111112211111111111111111111111111111222121211222222232111122212211---2221-------1331111111111111-1111111111111111111111112211111111111111111111111112-1---1-----1-11-2-1---11111111311111111111111111121111213122323322233322333212123221211111111112211112222222211111111----------------1-------------------------22221-2-1-111 ----331---1---------1----11--------------------111------------------------------------1---21-1-1-----------1-11------------121-2------------------------------2----111--31-2113111-----112112-211-1212- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---

Master   AminoSeq   


1: . . . . + .: 60 :MDLTHVTRYIAGRDTREPVCAYLYDLDDLRLRTTRLRAALPEQCALYYAVKANSDAPVLR:Sequence : ccccccccHHHHHcccccEEEEEHHHHHHHHHHcTTEEEEEEGGGcccHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|21->40|aylydlddlrlrttrlraal : ====================:RP:SCP|41->273|1hkvA2|4e-39|26.7|232/265|c.1.6.1 : =============:BL:SWS|48->395|DCDA_VIBCH|4e-31|32.5|329/417 : $$$$$$$$$$$$$$$$$$$$:RP:PFM|41->273|PF02784|9e-33|41.5|224/249|Orn_Arg_deC_N 61: . . . * . .: 120 :ALLGVADGFEVASFGEIERVRGVDAEVPIAFGGPGKTDAELEGALRLGVGLIHVESTLQL:Sequence :HHHHTTcEEEEccHHHHHHHHTccGGGcEEEccTTccHHHHHHHHHTTccEEEEccHHHH:Sec Str :============================================================:RP:SCP|41->273|1hkvA2|4e-39|26.7|232/265|c.1.6.1 :============================================================:BL:SWS|48->395|DCDA_VIBCH|4e-31|32.5|329/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->273|PF02784|9e-33|41.5|224/249|Orn_Arg_deC_N 121: . . + . . .: 180 :SRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEALLPDVLAQSRTMPNV:Sequence :HHHHHHHHHHTccEEEEEEcccccccccGGGccccTTccccccHHHHHHHHHHHHHcTTE:Sec Str :============================================================:RP:SCP|41->273|1hkvA2|4e-39|26.7|232/265|c.1.6.1 :============================================================:BL:SWS|48->395|DCDA_VIBCH|4e-31|32.5|329/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->273|PF02784|9e-33|41.5|224/249|Orn_Arg_deC_N 181: . * . . . .: 240 :RVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWLNVGGGIGIDYQNPERH:Sequence :EEEEEEccccccccccHHHHHHHHHHHHHHHHHHHTTTccccEEEccccccccTTccccc:Sec Str : ############## :PROS|218->231|PS00879|ODR_DC_2_2|PDOC00685| :============================================================:RP:SCP|41->273|1hkvA2|4e-39|26.7|232/265|c.1.6.1 :============================================================:BL:SWS|48->395|DCDA_VIBCH|4e-31|32.5|329/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->273|PF02784|9e-33|41.5|224/249|Orn_Arg_deC_N 241: + . . . . *: 300 :FDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVIDLKRNHDKWFAVLRGGT:Sequence :ccHHHHHHHHHHHTTTcccccEEEEcccHHHHTTTEEEEEEEEEEEccccccEEEEcccT:Sec Str :================================= :RP:SCP|41->273|1hkvA2|4e-39|26.7|232/265|c.1.6.1 : ==========================================:RP:SCP|259->393|1knwA1|9e-22|21.5|130/174|b.49.2.3 :============================================================:BL:SWS|48->395|DCDA_VIBCH|4e-31|32.5|329/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|41->273|PF02784|9e-33|41.5|224/249|Orn_Arg_deC_N 301: . . . . + .: 360 :HHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELCTPKDVLAREVPVDRLR:Sequence :TTccHHHHHcccccEEEcccccEEcccccTTccEEEEEEEcccccTTcEEEEEEEEEccc:Sec Str :============================================================:RP:SCP|259->393|1knwA1|9e-22|21.5|130/174|b.49.2.3 :============================================================:BL:SWS|48->395|DCDA_VIBCH|4e-31|32.5|329/417 361: . . . * . .: 420 :VGDRIAFTMAGAYGWHISHHDFLSHPHPERVFIGGQP :Sequence :TTcEEEEcccccccGGGccccTTTccccEEEEEcccE :Sec Str :================================= :RP:SCP|259->393|1knwA1|9e-22|21.5|130/174|b.49.2.3 :=================================== :BL:SWS|48->395|DCDA_VIBCH|4e-31|32.5|329/417