[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08007.1"

            "Hydrophobe/amphiphile efflux-1 HAE1"
            ""

OrgPattern -------------------------------------------------------------------- D9K-------------------------------------------11-1--111-11--11--1--1111------------44356FGIE-I24---23G4B8LBJ8C--------------342344533465111111--1-67455451122222534362E47A3-2-----2-----2111--11212222222222222221111212212112122------6311111111111111111111-----------------------------------------------------------------------6116-------1-1-1221--------1-13122522213-1-----31E3BG77C11111AENKRI9HLIJGD46574664547-NQGGPKML5A9-GAACBBDBBA8ABL7AA7495655544777777778CB866A61111111111--1-221141113311-111338936755BDHIGIBA7776CCGGAAAA7BDBHCGGN-5GHF7CA9BMFA7A7AGG9GAC8A111111187B6BF75A246764895531694779B77AA9AE92A62111222222333333333753598B875IE9JCDB6DEFFEHFKLFFHHDJQKMG--1B85B------76677B67999788A77-6887789768797777777CDC773456545666666546455A64664661-877777765778--17343335989H9C662111121111111117778759222A8DEEECCEFCDFEB99BC111111111A5AAB666669CDCBGHDADAA8BB54442297BC46BB11111111-----------------------------1---111118C6 -1-----------1------------------------------------------------------------------------------------------------------------------------------------------------6----6-2-------5-----------1--D-----7---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAQFFLRRPAFAWVLAILTMVAGLVALNSIPVAQYPAVAPPTVILYADYPGATARTVEDR:Sequence :cHHHHHHcTTTTTHHHHHHHHHHHHHHHHccccccccccccEEEEccccccccHHHHHTT:Sec Str : =:RP:SCP|60->210|1mwkA2|6e-30|12.1|140/163|c.55.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 61: . . . * . .: 120 :VTAVLEQQMHGIPGLLYIDSSSEAGTATVTIGFRQGTDPQLAQVNVRNRVSQAEPLLPEV:Sequence :THHHHcTTcccccccccccEEEETccEEccEEccTTccHHHHHHHHHHHHHHHGGGccHH:Sec Str :============================================================:RP:SCP|60->210|1mwkA2|6e-30|12.1|140/163|c.55.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 121: . . + . . .: 180 :VRRGGVYVDQASASPFMYVSLISKTGTMSETALADYAAGTVLPMLRRLPGIGKVEAYSAE:Sequence :HHHHcccEEEccccccEEEEEEEccccccHHHHHHHHHHTTHHHHHccccccEEEEcccc:Sec Str :============================================================:RP:SCP|60->210|1mwkA2|6e-30|12.1|140/163|c.55.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 181: . * . . . .: 240 :YALRVWFNPDQLNAYGLTTADVEAAIRARNGSVTPGQLGGAPSKPGQSYQAVVRPPAPLA:Sequence :cccEEEEcHHHHHTTTccHHHHHHHHTTTcccccccccccccccTTcccccccccccccc:Sec Str :============================== :RP:SCP|60->210|1mwkA2|6e-30|12.1|140/163|c.55.1.1 :============================================================:RP:SCP|181->271|1iwgA5|6e-23|47.3|91/92|d.225.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 241: + . . . . *: 300 :DPEAFGRIVLRSAADGSAVLLRDVARVEMAAADYRYSSTLNGREAASMGLKLADGANVLA:Sequence :cHHHHHccEEEccTTTccEEHHHHEEEEccccccccEEEETTEEcccEEEEccccccHHH:Sec Str :=============================== :RP:SCP|181->271|1iwgA5|6e-23|47.3|91/92|d.225.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 301: . . . . + .: 360 :TSRTVRDALDEAAKAFPAGVAYDISYDTAHFVQSSISRVLMTLAEATVLVFLILYLFLGN:Sequence :HHHHHHHHHTTTcccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHTTccc:Sec Str : =======================================:RP:SCP|322->497|1iwgA7|8e-36|51.1|176/199|f.35.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 361: . . . * . .: 420 :LRATLIPCIVVPVSLLGTVACLYAFGLSLNVITLFGVVLAIGILVDDAIVVVENVERIMR:Sequence :cTTTTHHHHHHHHHHHHHHHHHGGGTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT:Sec Str :============================================================:RP:SCP|322->497|1iwgA7|8e-36|51.1|176/199|f.35.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 421: . . + . . .: 480 :EEGVDAFTAASRSMREVSGALLAVTLVLCAVFVPMAFLGSAVGVIYRHFAMTLAISIAFS:Sequence :cccccHHHHHHHHTTTcHHHHTTHHHHHHTTTTTccccccTTTHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|440->453|allavtlvlcavfv :============================================================:RP:SCP|322->497|1iwgA7|8e-36|51.1|176/199|f.35.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 481: . * . . . .: 540 :LFFALSLAPAMCASLLRHGAQPARGPLAWFEHRFTAFTTRYAGWVQRLQQRRLRWLAVYL:Sequence :HHHTTTTHHHHcTTTcccTcccccHHHHTTTTTTTTHHHHHHHHHccccTTcTTTHHHHH:Sec Str : XXXXXXXXXXX :SEG|526->536|qrlqqrrlrwl :================= :RP:SCP|322->497|1iwgA7|8e-36|51.1|176/199|f.35.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 541: + . . . . *: 600 :AMAAVCAVGLWQLPSGFLPEEDTGELVIDVELPPGSTQAQTRETIAQLEQWMKQERLPVK:Sequence :HHHHHHHHHHHHccccccccccccEEEEEEEccTTccHHHHHHHHHHHHHTTccccTTEE:Sec Str : ========================================:RP:SCP|561->668|1iwgA3|7e-18|29.5|105/107|d.58.44.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 601: . . . . + .: 660 :TSFALLGWNSGGSGEQRASVFLSLDDWKLRGRENAADVVLARLTKGLEEWPGRGDAQLYP:Sequence :EEEEEEEEccccEEEEEEEEEEEEccTTTccGGGcHHHHHHHHHHHTcccTTTTEcccEE:Sec Str :============================================================:RP:SCP|561->668|1iwgA3|7e-18|29.5|105/107|d.58.44.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 661: . . . * . .: 720 :YNGTALPELGSTSGLDMRLVTRLEGGRPSLYAARDKLIERAKADPVFAEVRATAGQPVPA:Sequence :EcccTTccccccccEEEEEEccccccTTHHHHHHHHHHHHHHccGGccccEEcccccEEc:Sec Str :======== :RP:SCP|561->668|1iwgA3|7e-18|29.5|105/107|d.58.44.1 : ==:RP:SCP|719->806|1iwgA6|8e-20|36.4|88/88|d.225.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 721: . . + . . .: 780 :LDLAIDYRKAESFGVDTEAIHHALAATLGSRYIDELARDGRVRRVILQADAPFRMQPEDL:Sequence :ccccccHHHHHHTTccHHHHHHHHHHHHHcccccEEEccccEEEccccccGGGcccTTTG:Sec Str :============================================================:RP:SCP|719->806|1iwgA6|8e-20|36.4|88/88|d.225.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 781: . * . . . .: 840 :ARLHVRNAQGQMVSLGAFATLEWGNGEATLERYNGLISVRINADVAPGTSTGTAMTRLES:Sequence :GGcEEEcTTccEEEGGGcccccccEEccEEEEETTEEEEEEEEcccccccHHHHHHHHHH:Sec Str :========================== :RP:SCP|719->806|1iwgA6|8e-20|36.4|88/88|d.225.1.1 : =============================:RP:SCP|812->1024|1iwgA8|6e-33|40.4|213/222|f.35.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 841: + . . . . *: 900 :LVRELGPDYEVRWSGRAFEQQQSGTQAPWLFALSMLFIFLCLVALYESWTLPLAVLAIVP:Sequence :HHHTccTTcEEEEcHHHHHHHcccccHHHHHHHHHHHHHHHHHHHTTcccTTHHHHTTHH:Sec Str :============================================================:RP:SCP|812->1024|1iwgA8|6e-33|40.4|213/222|f.35.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 901: . . . . + .: 960 :AGLVGAASAVWLRGLPNDVYFKVGVIVIMGLAAKNAILVVEYAEQLRRNGLERVQAATQA:Sequence :HHHHHHcTTccccccccTTHHHHHHHHHHHHHHHHHHHHHHHHTTTTTccccTTTHHHHH:Sec Str : XXXXXXXX:SEG|953->966|rvqaatqaarqrlr :============================================================:RP:SCP|812->1024|1iwgA8|6e-33|40.4|213/222|f.35.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 961: . . . * . .:1020 :ARQRLRPVVMTSLAFILGVVPLAISTGPGAGAQRAVGTGVLGGMLGATILGTLVIPLLYA:Sequence :HHTTHHHHHHHHHHHHHHHccTTTcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :XXXXXX :SEG|953->966|rvqaatqaarqrlr :============================================================:RP:SCP|812->1024|1iwgA8|6e-33|40.4|213/222|f.35.1.1 :============================================================:BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran 1021: . . + . . .:1080 :WIARWSKARATTEPAKAPASEPGA :Sequence :HHH :Sec Str :==== :RP:SCP|812->1024|1iwgA8|6e-33|40.4|213/222|f.35.1.1 :==== :BL:SWS|1->1024|ACRD_ECOLI|0.0|43.0|1018/1037 :$$$ :RP:PFM|1->1023|PF00873|0.0|38.9|1007/1014|ACR_tran