[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08055.1"

            "peptide methionine sulfoxide reductase"
            ""

OrgPattern ------11------1---------21113111211---1111-21111-1111-----1--1----11 132-111111111111111-11111211111111111111111111111111111111--11111111111-11111111111-----1111-111---11212241142--------------111111111111111111112-222211211222222221212223122222222222211111--111122222222222222222111122221132331111111633333323332233333333112122321-133112211111222211122222112222222222222222222222222112221111-11111111121-2--111-111111111----221----1------1221-22222-----133222122222211111111111-22122133222-2111223222331223122111112221111111113311111-----------------------------122231111122222222111122421111112231213-11111111121212112221111-111111111221111112112111111111122121111212111111111111111111111111-11211112121422433322223262222222222---2111------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---211111223212122111-1--1111111111111112321211211233111111111222122222122212222233333221111111111111111221122--------111----1-1111-11---11111-1111-11------111 ----111-21111111111111111111111111111111111111111111111111-1--31111111111111111111111111-11111-111111-1222-1D122322211111-1121111461-2141111111111111-1111111122111411-3221-1121455c3242353461687442228 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDAMTTLQRWTRPTALKLASLAVLMVAAAMWELPAISAEAAVKIPAPAVDEKAGTSHTET:Sequence : cEEE:Sec Str : XXXXXXXXXXXXXXXX :SEG|15->30|alklaslavlmvaaam : =========================:RP:SCP|36->208|1ff3A|8e-59|42.4|172/211|d.58.28.1 : ============:BL:SWS|49->239|MSRA2_RHILO|3e-75|66.3|190/195 : $$:RP:PFM|59->209|PF01625|2e-41|55.7|149/156|PMSR 61: . . . * . .: 120 :AVFAGGCFWGVQGVFQHVRGVTRVTSGYSGGSASNAQYEMVGTGMTGHAESVEIRYDPTQ:Sequence :EEEEcccHHHHHHHHHTcTTEEEEEEEEEccccccccTTTHHHccHTcEEEEEEEEETTT:Sec Str :============================================================:RP:SCP|36->208|1ff3A|8e-59|42.4|172/211|d.58.28.1 :============================================================:BL:SWS|49->239|MSRA2_RHILO|3e-75|66.3|190/195 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|59->209|PF01625|2e-41|55.7|149/156|PMSR 121: . . + . . .: 180 :ISYGKLLQIFFSVAHNPTQLNYQGPDHGTQYRSAIFPRSPVQRSIAEAYITQLDTSKAYR:Sequence :ccHHHHHHHHHHHHcccccccEETTEEcGGGccEEEEccGGGHHHHHHHHHHHGHHHHHc:Sec Str :============================================================:RP:SCP|36->208|1ff3A|8e-59|42.4|172/211|d.58.28.1 :============================================================:BL:SWS|49->239|MSRA2_RHILO|3e-75|66.3|190/195 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|59->209|PF01625|2e-41|55.7|149/156|PMSR 181: . * . . . .: 240 :APIVTRVEDYKGFFPAENYHQDFLVKNPSYPYIVINDLPKIGNLKTMFPDVYRNDAVLVS:Sequence :cccccEEEEcccEEEccTTTTTHHHHcTTcccccGGGGGcccccGGGGccccHHH :Sec Str :============================ :RP:SCP|36->208|1ff3A|8e-59|42.4|172/211|d.58.28.1 :=========================================================== :BL:SWS|49->239|MSRA2_RHILO|3e-75|66.3|190/195 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|59->209|PF01625|2e-41|55.7|149/156|PMSR 241: + . . . . *: 300 :KGG :Sequence : :Sec Str