[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF08055.1 rmet0 ABF08055.1 "peptide methionine sulfoxide reductase"
MDAMTTLQRWTRPTALKLASLAVLMVAAAMWELPAISAEAAVKIPAPAVDEKAGTSHTET
AVFAGGCFWGVQGVFQHVRGVTRVTSGYSGGSASNAQYEMVGTGMTGHAESVEIRYDPTQ
ISYGKLLQIFFSVAHNPTQLNYQGPDHGTQYRSAIFPRSPVQRSIAEAYITQLDTSKAYR
APIVTRVEDYKGFFPAENYHQDFLVKNPSYPYIVINDLPKIGNLKTMFPDVYRNDAVLVS
KGG
//