[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08099.1"

            "dihydroorotate oxidase A"
PYRD_RALME  "RecName: Full=Dihydroorotate dehydrogenase;         EC=1.3.5.2;AltName: Full=Dihydroorotate oxidase;AltName: Full=DHOdehase;         Short=DHODase;         Short=DHOD;"

OrgPattern -----------------1-1111-11111111----11-----------1----1-111--------- 1---111111121211111-11111111111111111111----1111111111111111111-11-111111111111----111111121111----11111111111--------------------------11111---11111111111111111111111111111111111111111111---111----------------11111---------111111111111111111111111-11111------1---11----1-1-------------------------------------------------------------------------1-----11-1---1-1---1--1--1---1111111111111111111112111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------111111111-111111111111111111111111111111111111111111111111111111111111111111111111-1----------------11---111111--1111111111111111111111111111111111111111111111111111111111-1-11-1--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111--111111111111111111111111112111----------1111111111111111111111111111---1111111--------1-------------------------------1-----111 11----1-1---1111111111111111111111111111111111-111111111111111111111-11-111-----11111111-11111111111111----1112231111111111122111281-212-1111-111111111-1111111133121112118112111-1E1111121-21111221111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVPTPRRPWPRPTLVLNALYPLLRPALFSMDAEDAHHFTLNNLMRAKRMGLAGCIGNSIA:Sequence : HHHTHHHTHHHHHHHHccHHHHHHHHHHGHHHTHHHHTTcccccccG:Sec Str : XXXXXXXXXXX :SEG|3->13|ptprrpwprpt : ==============================================:BL:SWS|15->358|PYRD_RALME|0.0|99.7|344/344 61: . . . * . .: 120 :DDPRTVMGVRFPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPRPRMFRL:Sequence :GGcEEETTEEEcccEEEcTTccTTcccHHHHHHTTccEEEEEEEccccccccccccEEEE:Sec Str : #################### :PROS|97->116|PS00911|DHODEHASE_1|PDOC00708| : ========================================================:RP:SCP|65->357|1gt8A2|1e-66|21.9|283/310|c.1.4.1 :============================================================:BL:SWS|15->358|PYRD_RALME|0.0|99.7|344/344 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|62->356|PF01180|1e-67|51.4|284/290|DHO_dh 121: . . + . . .: 180 :PQADALINRMGFNNGGVDAFIRNVQASRWKAEGGVLGLNIGKNADTPIERAADDYLYCLE:Sequence :GGGTEEEEccccccccHHHHHHHHHTTHHHHHHTTccEEEEEcccTTcccHHHHHHHHHH:Sec Str :============================================================:RP:SCP|65->357|1gt8A2|1e-66|21.9|283/310|c.1.4.1 :============================================================:BL:SWS|15->358|PYRD_RALME|0.0|99.7|344/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|62->356|PF01180|1e-67|51.4|284/290|DHO_dh 181: . * . . . .: 240 :RVYPHASYVTVNISSPNTKNLRQLQGASELDSLLSTLKAAQQRLADQHKRYVPVALKIAP:Sequence :HHGGGccEEEEEcccTTcTTGGGGGcHHHHHHHHHHHHHHHHHHTccGGGccEEEEEEcc:Sec Str :============================================================:RP:SCP|65->357|1gt8A2|1e-66|21.9|283/310|c.1.4.1 :============================================================:BL:SWS|15->358|PYRD_RALME|0.0|99.7|344/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|62->356|PF01180|1e-67|51.4|284/290|DHO_dh 241: + . . . . *: 300 :DLDDDQVRNIGDALVRHKIDGVIATNTTISRDAVKGLPHAEEAGGLSGRPVFEASTRVVR:Sequence :cccHHHHHHHHHHHHHHTccEEEEccccccccTTcccTTTTcccEEEEGGGHHHHHHHHH:Sec Str :============================================================:RP:SCP|65->357|1gt8A2|1e-66|21.9|283/310|c.1.4.1 :============================================================:BL:SWS|15->358|PYRD_RALME|0.0|99.7|344/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|62->356|PF01180|1e-67|51.4|284/290|DHO_dh 301: . . . . + .: 360 :ALREVIGDALPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTLVRECASALRR :Sequence :HHHHHTTTcccEEEEcccccHHHHHHHHHHTccEEEEcHHHHHHcTHHHHHHHHHHHH :Sec Str : ##################### :PROS|312->332|PS00912|DHODEHASE_2|PDOC00708| :========================================================= :RP:SCP|65->357|1gt8A2|1e-66|21.9|283/310|c.1.4.1 :========================================================== :BL:SWS|15->358|PYRD_RALME|0.0|99.7|344/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|62->356|PF01180|1e-67|51.4|284/290|DHO_dh