[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08260.1"

            "Sulfate ABC transporter, permease protein CysW"
            ""

OrgPattern --112211111111111------2212231221-21-25555313154-1533-3523412---1--- --2131112232--33333-34--34333333444444441-1-231132212131-1--11212222211-------1111411111----11-----------1-1-----------------12122123212111221125323543332355------33235551------------3113312-51132323653433354353221133514442-1211212A8111111111111111111112--------------------------------1--------------------------1--111-----221344433431321444----312113246144213211-12211-12-1-3333-----335953354656656655666669-44433344464-888496587888861--14A689964122222222-33-2534-------------------------------111-4663433474434665889777774784A6546-2776432335385567981333683444444222243-36253221-5221-53213345-313242133-211-11--1-1111111112311114321311----14444121444616226222---32-------44332554444444444-4444444444444334434666674355555555554555555444434442-59978999998922-1---------4-51743441411111111344434233445534437567687753977---------12223444445527522333333332222--12332222--------1----1----------------------1443112153-5- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------222-----12---1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAGAISRLGGPGAPGAPSAHVQAAQFPHDATGESRWVRYGLITVAVLFLGLFLFIPLASV:Sequence : HH:Sec Str : XXXXXXXXXXX :SEG|9->19|ggpgapgapsa : ========:RP:SCP|53->266|2r6gG1|2e-23|19.3|207/284|f.58.1.1 : =========================:BL:SWS|36->266|CYSW_ECOLI|8e-76|55.4|231/291 61: . . . * . .: 120 :FYEALRKGVDTYLAALTEPDAVSAIKLTLTVAAIAVPLNVVFGVAAAWAIAKFDFRGKNL:Sequence :HHHHHHHTHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccTTHHH:Sec Str :============================================================:RP:SCP|53->266|2r6gG1|2e-23|19.3|207/284|f.58.1.1 :============================================================:BL:SWS|36->266|CYSW_ECOLI|8e-76|55.4|231/291 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|94->245|PF00528|2e-07|32.2|143/195|BPD_transp_1 121: . . + . . .: 180 :LITLIDLPFSVSPVISGLIYVLMFGAQGWFGPWLEAHDIKIMFAVPGIVLATIFVTFPFV:Sequence :HHHHHHGGGTccHHHHHHHHHHHHcTTcTTTGGGTTTccccTTcHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|53->266|2r6gG1|2e-23|19.3|207/284|f.58.1.1 :============================================================:BL:SWS|36->266|CYSW_ECOLI|8e-76|55.4|231/291 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|94->245|PF00528|2e-07|32.2|143/195|BPD_transp_1 181: . * . . . .: 240 :ARELIPLMQAQGSEEEEAAIVLGASGWQTFWHVTLPNIRWGLLYGVILCNARAMGEFGAV:Sequence :HHHHHHHHHHccHHHHTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHH:Sec Str :============================================================:RP:SCP|53->266|2r6gG1|2e-23|19.3|207/284|f.58.1.1 :============================================================:BL:SWS|36->266|CYSW_ECOLI|8e-76|55.4|231/291 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|94->245|PF00528|2e-07|32.2|143/195|BPD_transp_1 241: + . . . . *: 300 :SVVSGHIRGLTNTMPLHVEILYNEYNFAAAFAVASLLTLLALVTLGIKTLVEIRASREQL:Sequence :HHHH :Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|267->285|faaafavaslltllalvtl :========================== :RP:SCP|53->266|2r6gG1|2e-23|19.3|207/284|f.58.1.1 :========================== :BL:SWS|36->266|CYSW_ECOLI|8e-76|55.4|231/291 :$$$$$ :RP:PFM|94->245|PF00528|2e-07|32.2|143/195|BPD_transp_1 301: . . . . + .: 360 :EGQPS :Sequence : :Sec Str