[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF08260.1 rmet0 ABF08260.1 "Sulfate ABC transporter, permease protein CysW"
MAGAISRLGGPGAPGAPSAHVQAAQFPHDATGESRWVRYGLITVAVLFLGLFLFIPLASV
FYEALRKGVDTYLAALTEPDAVSAIKLTLTVAAIAVPLNVVFGVAAAWAIAKFDFRGKNL
LITLIDLPFSVSPVISGLIYVLMFGAQGWFGPWLEAHDIKIMFAVPGIVLATIFVTFPFV
ARELIPLMQAQGSEEEEAAIVLGASGWQTFWHVTLPNIRWGLLYGVILCNARAMGEFGAV
SVVSGHIRGLTNTMPLHVEILYNEYNFAAAFAVASLLTLLALVTLGIKTLVEIRASREQL
EGQPS
//