[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08451.1"

            "transcriptional regulator"
            ""

OrgPattern -----------------------12--1-1-1--1------------1--843--------------- 356----1111--------------1--------------11-12---------1-------------1--------------------------------------111------------------------------------211111---------------1-11------------1----------------------------------------1------------------------------------------------------------------------------------------------------1------------11------------------------1-1----111---------113331111--1-------------12312211221-1221-111212312----------1-1-------------2-1-------------------------------1-------------------1112--------31311-2---2-----1211-22--222-----------42211--21----1-11--2235214141231-2-2------------------------3------111----1-11111-1---------1---2---------1-2--------------------------------------------------------------------1------------------------2-2----------------------------1--1-----1------12----------------------------------------1------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1--2- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTISTNTAAQILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQ:Sequence : HHHcccHccccccccEEEEEETTccEEEEcHHHHHHHcccHHHHTTccGGGGccTTHH:Sec Str : ===================================================:RP:SCP|10->122|1s66L|2e-23|26.1|111/119|d.110.3.2 : ==================================================:BL:SWS|11->126|FIXL_RHIME|4e-11|31.6|114/505 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->124|PF08448|9e-14|35.8|109/111|PAS_4 61: . . . * . .: 120 :AAHWKGFQAAIDTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARD:Sequence :HHHHHHHHHHHHHcccccTTTcEEEEEEcTTccEEEEEEEEEEEEEEETTEEEEEEEEEE:Sec Str :============================================================:RP:SCP|10->122|1s66L|2e-23|26.1|111/119|d.110.3.2 :============================================================:BL:SWS|11->126|FIXL_RHIME|4e-11|31.6|114/505 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->124|PF08448|9e-14|35.8|109/111|PAS_4 121: . . + . . .: 180 :VTDKVERERAQSAAGPVSR :Sequence :cHHHHHHHHHHHHc :Sec Str :== :RP:SCP|10->122|1s66L|2e-23|26.1|111/119|d.110.3.2 :====== :BL:SWS|11->126|FIXL_RHIME|4e-11|31.6|114/505 :$$$$ :RP:PFM|12->124|PF08448|9e-14|35.8|109/111|PAS_4