[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08536.1"

            "monooxygenase, FAD-binding"
            ""

OrgPattern ----------------1----------------1111111111-----11----1---------1--- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------1-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPSARHPPPFTFTSSCLHPRTGYSRPSNHQRGTEMATRTQDFDHDVVIVGASFAGAACAL:Sequence : :Sec Str : XXXXXXXXXXX:SEG|50->74|gasfagaacalaaaraglrvvvler 61: . . . * . .: 120 :AAARAGLRVVVLERKTDPGSKLHTTGILVKEAAEQTWLGRAPADCLRRIEKVHLYSPALR:Sequence : :Sec Str :XXXXXXXXXXXXXX :SEG|50->74|gasfagaacalaaaraglrvvvler : XXXXXXX:SEG|114->127|lyspalrslalaap 121: . . + . . .: 180 :SLALAAPGYYFLTTDTPNLMRWLASELVNHGVDLRLGTSFSQASRSGAGWSVPGVGRTRY:Sequence : cccEEEEEHHHHHHHHHHHHHHTTcEEEccccEEEEEEETTEEEEEETTEEEE:Sec Str :XXXXXXX :SEG|114->127|lyspalrslalaap : ====:RP:SCP|177->392|3c96A1|3e-06|14.0|193/269|c.3.1.2 : ====:BL:SWS|177->372|GGR_METJA|2e-13|30.0|180/391 181: . * . . . .: 240 :LVGADGARSRVAQIAGLGQGNAFLYGVEYEFAGLQLSDPDALHCFASKHFAPGYIGWVAQ:Sequence :EEEccGGGHHHGGGGTEEcccEEEEEEEEEEcccHHHHcGGGTccEEEEEETTEEEEEEc:Sec Str :============================================================:RP:SCP|177->392|3c96A1|3e-06|14.0|193/269|c.3.1.2 :============================================================:BL:SWS|177->372|GGR_METJA|2e-13|30.0|180/391 241: + . . . . *: 300 :NPTGVQAGLALRHAPRRRAAPDIDGFLRRVRHLLGVPEDAAPTTTRAGLIPCGGPVYPLA:Sequence :ccTTccEEEEEccccEEccTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHGGGcccccHHH:Sec Str : XXXXXXXXXXXXX :SEG|249->261|lalrhaprrraap :============================================================:RP:SCP|177->392|3c96A1|3e-06|14.0|193/269|c.3.1.2 :============================================================:BL:SWS|177->372|GGR_METJA|2e-13|30.0|180/391 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|269->338|PF05834|3e-05|38.8|67/368|Lycopene_cycl 301: . . . . + .: 360 :RDGVLLTGDAAGIVSPVTAGGIHAAWRHGEAVGRAIAAHLRTGAATPEQVAEQSAPRFRT:Sequence :HHHHHHHTcccHHHHTTcccccHHHHHHHHHHHHHHHHHHHHTTcEEEHHHTcccccccH:Sec Str :============================================================:RP:SCP|177->392|3c96A1|3e-06|14.0|193/269|c.3.1.2 :============================================================:BL:SWS|177->372|GGR_METJA|2e-13|30.0|180/391 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|269->338|PF05834|3e-05|38.8|67/368|Lycopene_cycl 361: . . . * . .: 420 :KRLLRWAFDHFQSDWAFDVLLHSAPLRWVAERIYFHKRGVAAEI :Sequence :HHHHHHHHTTTTTTccEEEEEcTTcccEEEEETTccGGGGH :Sec Str :================================ :RP:SCP|177->392|3c96A1|3e-06|14.0|193/269|c.3.1.2 :============ :BL:SWS|177->372|GGR_METJA|2e-13|30.0|180/391