[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08549.1"

            "Transposase and inactivated derivatives-like protein"
            ""

OrgPattern ---------------------------------------------------1---------------- --4---26445--4------------------------2--298-----------------------1----------------------------6-------------------------------------------------3-------------------1-----------------8--------------31-1--------------5-------9-------26214-12-5552-4-38788---24-1-------1-----1--C3-------------------------------------3244-------------------------------------------4---------------------1-3----------22212221224---6--F2-36--4--G---E-------131------1----------4-1---------------------------------6--41-------------71-1111-12125--------2------------31------------------------------------------------------------------------------------------------112------1-3--1---------------------------1-2------29---2---4------E1-----------A--3--3---A-----------121-11-1-12--2--------------1---------------3-3-3---------2------------------------1--B--------------4-----11------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------6--------------------------2-----------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIKELPAGVAKVLKRLHHPLDVILLCVRWYVAYSLSLRDLEEMMAERGLAVDHSMVHRWV:Sequence : :Sec Str : ========================================:BL:SWS|21->212|T431_STAAW|4e-32|37.8|188/224 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->125|PF03050|8e-19|48.4|93/160|Transposase_25 61: . . . * . .: 120 :IKLLPLFEKAFRRHKRSVSKSWRMDETYLKVRGKWAYLYRAVDKAGNTIDFLLCARRDKV:Sequence : EEEEEEEcGGGTTccEEEEEEETTTccEEEEEEccccHH:Sec Str :============================================================:BL:SWS|21->212|T431_STAAW|4e-32|37.8|188/224 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->125|PF03050|8e-19|48.4|93/160|Transposase_25 121: . . + . . .: 180 :AARRYFEKAIGQNGAPDTVAIDKSAANLAALHAVNAHRETPIRIRQRKYLNNIVEQDHRA:Sequence :HHHHHHHHHHHHHccccEEEEEccHHHHcHHHHHHHHHHTcEEEEEcTTHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|145->157|aanlaalhavnah :============================================================:BL:SWS|21->212|T431_STAAW|4e-32|37.8|188/224 :$$$$$ :RP:PFM|33->125|PF03050|8e-19|48.4|93/160|Transposase_25 181: . * . . . .: 240 :IKRRARPMLGFKNFRCARILIGGIETMHMIAKGRCGDPKAFACPPRSNSIPWFHRPAHSS:Sequence :HHHHHHHHHHHTTccccccHHHHHHHHHHH :Sec Str :================================ :BL:SWS|21->212|T431_STAAW|4e-32|37.8|188/224 241: + . . . . *: 300 :PPASTNRPYRDRTKGAGAPAFGIQTPFDSSRGSLLLQWQARLMIFDALSPTSRFHSVPEA:Sequence : :Sec Str 301: . . . . + .: 360 :MHLGKVVVDRGFRRPQSSLRVDTASYRINLAGERHVSRTHQ :Sequence : :Sec Str