[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF08549.1 rmet0 ABF08549.1 "Transposase and inactivated derivatives-like protein"
MIKELPAGVAKVLKRLHHPLDVILLCVRWYVAYSLSLRDLEEMMAERGLAVDHSMVHRWV
IKLLPLFEKAFRRHKRSVSKSWRMDETYLKVRGKWAYLYRAVDKAGNTIDFLLCARRDKV
AARRYFEKAIGQNGAPDTVAIDKSAANLAALHAVNAHRETPIRIRQRKYLNNIVEQDHRA
IKRRARPMLGFKNFRCARILIGGIETMHMIAKGRCGDPKAFACPPRSNSIPWFHRPAHSS
PPASTNRPYRDRTKGAGAPAFGIQTPFDSSRGSLLLQWQARLMIFDALSPTSRFHSVPEA
MHLGKVVVDRGFRRPQSSLRVDTASYRINLAGERHVSRTHQ
//