[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08555.1"

            "membrane protein-like protein"
            ""

OrgPattern -------------------------------------------------------------------- -1----------------------------------------------------------------------------------------1--1------1-1--11--1---------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------11-------111111-----111-------11----1--111---------11--1-----------------1--1-1--1---------1-1-------------------------------------1---------------------------------------------11------------------------------------------------------------------------------------------------1-----------------------1-1--11111-1111-----11-------------------------1111111111---------1----------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLWILGLIGLIVGASVWGGEGAVVGAAVGAALGWVLRENAQQDALPVRKGEGPSLAQRVS:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|4->36|ilgliglivgasvwggegavvgaavgaalgwvl 61: . . . * . .: 120 :ALEREVAELKRALGAAGAGYANGAVDSETSDYSETVRSEVPERPPVIPVPASHSAVAATA:Sequence : XXXXXXXXXXXXX :SEG|72->84|algaagagyanga : XXXXXXXXXXXXXXXXXXXXXXXXX:SEG|96->138|vrsevperppvipvpashsavaatavsavpipvaaapgsapap 121: . . + . . .: 180 :VSAVPIPVAAAPGSAPAPMSRTQVVSHQDVPEIVPVSAASPRPASSSDMPFVVASDIDFA:Sequence :XXXXXXXXXXXXXXXXXX :SEG|96->138|vrsevperppvipvpashsavaatavsavpipvaaapgsapap : XXXXXXXXXXXXXX :SEG|154->167|vpvsaasprpasss 181: . * . . . .: 240 :KHLFREALDWLLGGNSVARVGILILFFGVAFLLKYAADNSILPVEFRLAGVCLGAVGLLA:Sequence : XXXXXXXXXXXXXX:SEG|227->246|rlagvclgavgllalgwrlr : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|192->514,981->1081|PF10101|8e-52|46.7|410/690|DUF2339 241: + . . . . *: 300 :LGWRLRTRRPGYALAVQGAGVGVLYLTVFAAARLYDLLPAGAAFALMVLVCGLAAGLAIL:Sequence :XXXXXX :SEG|227->246|rlagvclgavgllalgwrlr :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|192->514,981->1081|PF10101|8e-52|46.7|410/690|DUF2339 301: . . . . + .: 360 :QNASVLAVTGSAGGFLAPVLISTGGGSHVMLFSYYALLNTGIFVIAWFRAWRVLNLLGFV:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|192->514,981->1081|PF10101|8e-52|46.7|410/690|DUF2339 361: . . . * . .: 420 :FTFGIATLWGVLSYKPALLSTTEPFLILFFLLYTGIALLYALRRSVQLTGYVDGTLIFGT:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|192->514,981->1081|PF10101|8e-52|46.7|410/690|DUF2339 421: . . + . . .: 480 :PLAMAGLQAALMRGTPFGMAWSAVAMAAFYFALAAGLLRHRQRLGLLFDALLALGVIFAT:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|440->475|awsavamaafyfalaagllrhrqrlgllfdallalg :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|192->514,981->1081|PF10101|8e-52|46.7|410/690|DUF2339 481: . * . . . .: 540 :LAIPLGFDGRTTCAVWALEGAGVVWIAMRQQRRLPLWCGLLLQFAAGFAFLAGALGDTEP:Sequence : XXXXXXXXXXXXXXXXXX :SEG|519->536|glllqfaagfaflagalg :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|192->514,981->1081|PF10101|8e-52|46.7|410/690|DUF2339 541: + . . . . *: 600 :GAWPVFNARYIGTMLLALAGFFSAWCLLAREQVRTWVPFVQEWGLMVALWGVWWWLGGGV:Sequence : XXXXXXXXXXXXXXXXXX:SEG|583->600|wglmvalwgvwwwlgggv 601: . . . . + .: 660 :FEIWHWHVEQGWSVQDLLRGWLLFAVLSAWLAHLGSRAADWPLAGFPALGLTPVQALLCI:Sequence 661: . . . * . .: 720 :ASCAVWTGPPLGGSGLLTWPLAFVASWWLLKRQEAAHADTWLAPLHTLLFLTLCVLLSDE:Sequence : XXXXXXXXXXXXXXXX :SEG|666->681|wtgpplggsglltwpl : XXXXXXXXXXXXXXXXXX :SEG|700->717|twlaplhtllfltlcvll 721: . . + . . .: 780 :GYWRLRAFVPEGAWSWAAWTFGHGCLLAVLAGAGLRLHWPVRRFARAYLLWAALPLAALL:Sequence : XXXXXXXXXXXXXX :SEG|744->757|gcllavlagaglrl : XXXXXXXXXXXXXXXX:SEG|765->790|arayllwaalplaallwiwslaslvs 781: . * . . . .: 840 :WIWSLASLVSDGAADPLPFVPFLNPLDVGQMLVIVALVLWRRRVLALELASQPRGLEYAA:Sequence :XXXXXXXXXX :SEG|765->790|arayllwaalplaallwiwslaslvs : XXXXXXXXXXXXXXXXXXX :SEG|812->830|lvivalvlwrrrvlalela 841: + . . . . *: 900 :LGTVFLWLNAVLLRTLHHHFGVRYAVPEILESLNLQLVFLAGWGAIVLAALWRVREPAVV:Sequence : XXXXXXXX:SEG|893->906|rvrepavvrvaafa 901: . . . . + .: 960 :RVAAFASAPLVLVMLLWSLYANLTQPGTLLGRIPLLNPLDLIMLLTFGAAVLWWLRAPVA:Sequence :XXXXXX :SEG|893->906|rvrepavvrvaafa : XXXXXXXXXXXXX :SEG|933->945|ipllnpldlimll : ===============:BL:SWS|946->988|YEEO_ECOLI|8e-04|34.9|43/100 961: . . . * . .:1020 :GLPVDLHTRAAGALGAGIVLIWLNAVLLRTLHHWQGVPYTLHDLAGSTLVQASLSVFWTV:Sequence : XXXXXXXX :SEG|970->977|aagalgag : XX:SEG|1019->1035|tvlallamlvatrravr :============================ :BL:SWS|946->988|YEEO_ECOLI|8e-04|34.9|43/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|192->514,981->1081|PF10101|8e-52|46.7|410/690|DUF2339 1021: . . + . . .:1080 :LALLAMLVATRRAVRSLWLVGGGLLAVTVMKMFLVDLSFLSGVARIVSFIAVGGLLLLIG:Sequence :XXXXXXXXXXXXXXX :SEG|1019->1035|tvlallamlvatrravr :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|192->514,981->1081|PF10101|8e-52|46.7|410/690|DUF2339 1081: . * . . . .:1140 :YLSPMPPAAKEGV :Sequence :$ :RP:PFM|192->514,981->1081|PF10101|8e-52|46.7|410/690|DUF2339