[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF08555.1 rmet0 ABF08555.1 "membrane protein-like protein"
MLWILGLIGLIVGASVWGGEGAVVGAAVGAALGWVLRENAQQDALPVRKGEGPSLAQRVS
ALEREVAELKRALGAAGAGYANGAVDSETSDYSETVRSEVPERPPVIPVPASHSAVAATA
VSAVPIPVAAAPGSAPAPMSRTQVVSHQDVPEIVPVSAASPRPASSSDMPFVVASDIDFA
KHLFREALDWLLGGNSVARVGILILFFGVAFLLKYAADNSILPVEFRLAGVCLGAVGLLA
LGWRLRTRRPGYALAVQGAGVGVLYLTVFAAARLYDLLPAGAAFALMVLVCGLAAGLAIL
QNASVLAVTGSAGGFLAPVLISTGGGSHVMLFSYYALLNTGIFVIAWFRAWRVLNLLGFV
FTFGIATLWGVLSYKPALLSTTEPFLILFFLLYTGIALLYALRRSVQLTGYVDGTLIFGT
PLAMAGLQAALMRGTPFGMAWSAVAMAAFYFALAAGLLRHRQRLGLLFDALLALGVIFAT
LAIPLGFDGRTTCAVWALEGAGVVWIAMRQQRRLPLWCGLLLQFAAGFAFLAGALGDTEP
GAWPVFNARYIGTMLLALAGFFSAWCLLAREQVRTWVPFVQEWGLMVALWGVWWWLGGGV
FEIWHWHVEQGWSVQDLLRGWLLFAVLSAWLAHLGSRAADWPLAGFPALGLTPVQALLCI
ASCAVWTGPPLGGSGLLTWPLAFVASWWLLKRQEAAHADTWLAPLHTLLFLTLCVLLSDE
GYWRLRAFVPEGAWSWAAWTFGHGCLLAVLAGAGLRLHWPVRRFARAYLLWAALPLAALL
WIWSLASLVSDGAADPLPFVPFLNPLDVGQMLVIVALVLWRRRVLALELASQPRGLEYAA
LGTVFLWLNAVLLRTLHHHFGVRYAVPEILESLNLQLVFLAGWGAIVLAALWRVREPAVV
RVAAFASAPLVLVMLLWSLYANLTQPGTLLGRIPLLNPLDLIMLLTFGAAVLWWLRAPVA
GLPVDLHTRAAGALGAGIVLIWLNAVLLRTLHHWQGVPYTLHDLAGSTLVQASLSVFWTV
LALLAMLVATRRAVRSLWLVGGGLLAVTVMKMFLVDLSFLSGVARIVSFIAVGGLLLLIG
YLSPMPPAAKEGV
//