[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF08589.1 rmet0 ABF08589.1 "hypothetical protein"
MLGSSMAWPKDQLLCARAWLTLSLGAYSTMFKTGYWLIIIGFWAALAGVFLCDPVGGLPE
NVNLFSFALRGLEIHLFKLSEAPQHYLITVLARDWLIGCFVTMFVGAVLLALGWRRRRQS
RLV
//