[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08608.1"

            "L-carnitine dehydratase/bile acid-inducible protein F"
            ""

OrgPattern --1----232523322-11321-51--12-32-----------------------------1-2---- --235--2---1--5UI44-4G--CS444448FDHE5HRi-K3Y1--2----442212--12B123B6635-111----1616------------------2------12--------------------------66686---32----------------------------------------11---11----------------1--------22323--------1----------------------2------2-1--11--------------------------------------------------------12--2222222-2--3-------1---1----87-1----1--------1--633A-----2-JBC--7B59A533442443442-34A33E39855-41111222133296472759222426722222222511--723------------------------------47F7-5uaHfEDDFIF5577799GE887858V6TQbkc2678564898N8H9OT456----21-------1--922-121------------2--2----111111-6---------------------------1---1-4-3--1------1----1-11-1--------------1-2-3--3443333333-2333333333233223221------111111111111111111122333321-----------------111111111-2212---------------44324242222155553656342455223------------------------------------------111111------------------------------------------------- ----111-----1126565644269773311112214666566222334867C9668124331-1---------1------111-1---25453243111113432-2-24252231111222223251AU3-6332222412222212221151632723112222232A1222-1------111--83---11111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSAILQGIKVLDLTRVVAGPWATQNLADMGATVYKIEKPGDGDDTRRMGPFLTDGDGNVT:Sequence :cccTTTTcEEEEcccTTHHHHHHHHHHHTTcEEEEEEcTTTccGGGcTTcccTTcTTTcc:Sec Str : ========================================================:RP:SCP|5->405|1xa3A|e-101|23.6|381/400|c.123.1.1 : ========================================================:BL:SWS|5->405|CG010_MOUSE|6e-79|40.4|391/436 61: . . . * . .: 120 :NDSAFFLCCNRGKQSVTVDISQPEGAELVRQLASHCDVVVENYKAGSLKKYGLDYESIRA:Sequence :cccHHHHTTcTTcEEEEccTTcHHHHHHHHHHHHHHHHHHTTccTTcccHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|5->405|1xa3A|e-101|23.6|381/400|c.123.1.1 :============================================================:BL:SWS|5->405|CG010_MOUSE|6e-79|40.4|391/436 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|76->268|PF02515|2e-37|41.8|189/189|CoA_transf_3 121: . . + . . .: 180 :LRPDIIYCSVTGFGPDGPYAPRPAYDFILQGMAGLMSTCGQPDGTPGAAPMRTAIPLTDI:Sequence :HcHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHTTcTTccccccccHHHHHHHH:Sec Str :============================================================:RP:SCP|5->405|1xa3A|e-101|23.6|381/400|c.123.1.1 :============================================================:BL:SWS|5->405|CG010_MOUSE|6e-79|40.4|391/436 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|76->268|PF02515|2e-37|41.8|189/189|CoA_transf_3 181: . * . . . .: 240 :LTGLYASVALMGALYHRQATGEGQFIDAAMIDAAVAANGHLALGYHMTGKVPQRAGNSNP:Sequence :HHHHHHHHTccHHHHHHGHHccccEEEEEHHHHHHHHTHHHHHHHHTTcccccccTTccc:Sec Str : XXXXXXXXXXXX :SEG|206->217|idaamidaavaa :============================================================:RP:SCP|5->405|1xa3A|e-101|23.6|381/400|c.123.1.1 :============================================================:BL:SWS|5->405|CG010_MOUSE|6e-79|40.4|391/436 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|76->268|PF02515|2e-37|41.8|189/189|CoA_transf_3 241: + . . . . *: 300 :VASPSEVFACLDGHVIIAAGNNGQFAALCRVIGCASLIEDPRFLQNMDRVRNRPVLRETL:Sequence :ccTTEEEEEETTEEEEEEcccHHHHHHHHHHTTcGGGcccTTTccHHHHGGGHHHHHHHH:Sec Str :============================================================:RP:SCP|5->405|1xa3A|e-101|23.6|381/400|c.123.1.1 :============================================================:BL:SWS|5->405|CG010_MOUSE|6e-79|40.4|391/436 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|76->268|PF02515|2e-37|41.8|189/189|CoA_transf_3 301: . . . . + .: 360 :GERLLNWRLADLIQALEGAGVPCGPINDIDDVFDDPQVRHRELLVRLPHGSGVEAPTLRS:Sequence :HHHHTTccHHHHHHHHGGGTccEEEcccHHHHHHcHHHHHTTcEEEEEETTTEEEEEEcc:Sec Str :============================================================:RP:SCP|5->405|1xa3A|e-101|23.6|381/400|c.123.1.1 :============================================================:BL:SWS|5->405|CG010_MOUSE|6e-79|40.4|391/436 361: . . . * . .: 420 :PLRFSATPVTMTAPPQLGQHTEAALRSELGMSAADVEAFRERGVI :Sequence :ccccTTccccccccccTTTTHHHHHHHHTTccHHHHHHHHHTTcc :Sec Str :============================================= :RP:SCP|5->405|1xa3A|e-101|23.6|381/400|c.123.1.1 :============================================= :BL:SWS|5->405|CG010_MOUSE|6e-79|40.4|391/436