[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF08608.1 rmet0 ABF08608.1 "L-carnitine dehydratase/bile acid-inducible protein F"
MSAILQGIKVLDLTRVVAGPWATQNLADMGATVYKIEKPGDGDDTRRMGPFLTDGDGNVT
NDSAFFLCCNRGKQSVTVDISQPEGAELVRQLASHCDVVVENYKAGSLKKYGLDYESIRA
LRPDIIYCSVTGFGPDGPYAPRPAYDFILQGMAGLMSTCGQPDGTPGAAPMRTAIPLTDI
LTGLYASVALMGALYHRQATGEGQFIDAAMIDAAVAANGHLALGYHMTGKVPQRAGNSNP
VASPSEVFACLDGHVIIAAGNNGQFAALCRVIGCASLIEDPRFLQNMDRVRNRPVLRETL
GERLLNWRLADLIQALEGAGVPCGPINDIDDVFDDPQVRHRELLVRLPHGSGVEAPTLRS
PLRFSATPVTMTAPPQLGQHTEAALRSELGMSAADVEAFRERGVI
//