[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08673.1"

            "protein of unknown function DUF214"
            ""

OrgPattern -------------------------------------------------------------------- -11-----------------------------------------------------------------------------------------------------------------------------11-1-----------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------1---11-111------1------------------------1-----------------------------------------111111-----11-1------11-1111------------------1----------------------------1---1-111-111-1-----111--------------------------------1-----------------------1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-----------------------------------------------------------1-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVIPLHYIARNVWARRLTTTLTAGGLALVVFVFATMLMLDAGLKRTLVTTGERDNVVLIR:Sequence : XXXXXXXXXXXXXXX :SEG|14->28|arrltttltagglal 61: . . . * . .: 120 :KGAETEIQSAISRDQAAAMEMHSAVALTPEGRPMSSREAVVLISLTKTGYTTPSNVVIRG:Sequence 121: . . + . . .: 180 :ITPLGVEMRPQVRLTRGRMFKPGSSEIIVGSSIAKGYDNVSIGDHLRFAQRDWTVVGHFD:Sequence 181: . * . . . .: 240 :AGGSGFDSEIWGDVDQLMQSFRRTSYSSMAVRLADSDAFDRFRADIDVDPRLANEAKREQ:Sequence : XXXXXXXXXXXXXXXXXX :SEG|212->229|rladsdafdrfradidvd 241: + . . . . *: 300 :QFYSDQSKALSAFINILGLTLTTIFSVAAMIGAMITMYASVANRVGEIGTLRALGFQRIN:Sequence : =========================================================:BL:SWS|244->386|MACB_BDEBA|6e-10|31.1|135/650 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|252->379|PF02687|1e-07|28.3|127/177|FtsX 301: . . . . + .: 360 :VLAAFLIEAVLLGLVGGVAGLLCASLMQFASFSTTNFQTFADLSFRFVLTPGIVIKTLLF:Sequence : XXXXXXXXXXXXXX :SEG|309->322|avllglvggvagll :============================================================:BL:SWS|244->386|MACB_BDEBA|6e-10|31.1|135/650 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|252->379|PF02687|1e-07|28.3|127/177|FtsX 361: . . . * . .: 420 :SMTMGLIGGFLPALRASRLNIVDALRAR :Sequence :========================== :BL:SWS|244->386|MACB_BDEBA|6e-10|31.1|135/650 :$$$$$$$$$$$$$$$$$$$ :RP:PFM|252->379|PF02687|1e-07|28.3|127/177|FtsX