[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF08673.1 rmet0 ABF08673.1 "protein of unknown function DUF214"
MVIPLHYIARNVWARRLTTTLTAGGLALVVFVFATMLMLDAGLKRTLVTTGERDNVVLIR
KGAETEIQSAISRDQAAAMEMHSAVALTPEGRPMSSREAVVLISLTKTGYTTPSNVVIRG
ITPLGVEMRPQVRLTRGRMFKPGSSEIIVGSSIAKGYDNVSIGDHLRFAQRDWTVVGHFD
AGGSGFDSEIWGDVDQLMQSFRRTSYSSMAVRLADSDAFDRFRADIDVDPRLANEAKREQ
QFYSDQSKALSAFINILGLTLTTIFSVAAMIGAMITMYASVANRVGEIGTLRALGFQRIN
VLAAFLIEAVLLGLVGGVAGLLCASLMQFASFSTTNFQTFADLSFRFVLTPGIVIKTLLF
SMTMGLIGGFLPALRASRLNIVDALRAR
//