[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08678.1"

            "transcriptional regulator, ArsR family"
            ""

OrgPattern -------------------------------------------------------------------- 137-3---------21111-12--1211111154443365-1221511---1331--3--211-3-3-2--------------------------------1---1-4-3------------------------------------1-------------------1--1-------------1----------11111111-1111111111--111---1---------22------------------------------------------------------------------------------------------------------------------------------------1-------5--5113-----134321-1---------------3--111----796-244-54165445--2231521111112-----------------------------------------------112--2222122221-----221-------41-2212--112-----1-1-1--1--------------------1-----------------------324247-------------------------------------------------------------------------------------------------------------------------------------2------------------------------------1----------------------------1-----------------------------------------22----------------332222-----------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLNYSDPHVALDATFQALADTTRRTMLAQLARGPLSVTELARPLAMSLPAVMQHLSVLEQ:Sequence :HHHHcccTHHHHHHHHccccHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHH:Sec Str : ==================================================:RP:SCP|11->89|1r1uA|7e-15|20.3|79/94|a.4.5.5 : =================================================:BL:SWS|12->73|YUZN_BACSU|7e-08|46.8|62/92 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|20->64|PF01022|8e-07|53.3|45/47|HTH_5 61: . . . * . .: 120 :AGLVRTEKVGRVRTCTMAPKALSEAEQWINARRAEWEGHFDRLGEYLETMKKEAASDGNG:Sequence :TTcccEEETTTEEEcccccccccHHHHHHTcccccEEEccccccHHHHHcHEEEcc :Sec Str :============================= :RP:SCP|11->89|1r1uA|7e-15|20.3|79/94|a.4.5.5 :============= :BL:SWS|12->73|YUZN_BACSU|7e-08|46.8|62/92 :$$$$ :RP:PFM|20->64|PF01022|8e-07|53.3|45/47|HTH_5 121: . . + . . .: 180 :N :Sequence : :Sec Str