[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08687.1"

            "2,3-dimethylmalate lyase"
            ""

OrgPattern 11---11111111112-221121-11111113111----1-112-232----------11-221--13 -----1-1222---112-------14-----------1-11221111--111211111--1-1-------------------1-----211--------------------------------------------------221-2---1----------1-1----11-1-------1------1-----2-1111111121121112111111111---11--11111--1--------------------------------------------------------11111112111---------------------------1-------1-----------2---------------11-----1-----2111-------123--123112----------1---1--2--121-1--3--------1-11-211----1-1111111111-----21-----------------------------1--31-464142223222232222433333-23271313--222--1211-1-2211---1-111111111112-1-11-----------1----11-212-----3--1--1-1-1211-2--------1-----21-11-111111222221111121121111---212-------1---1--1111111111-11-111111111111-111---1112-1111111111111111------------------------11111111111-1122---------------11111111112-22223342232232222-----------1-1111111111112111111111111---1--11----------1---------------------------------1------ -----1--------1211133324445---------1111111---21122354-----111------------1--------------231111-------1----121------------------------------------------------------1--------1-122-G121-112321611221221 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNAHDPNLLATSRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQF:Sequence : cTHHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHTTcccEEEcHHccTTcc:Sec Str : ==============================================:RP:SCP|15->298|1m1bA|2e-33|68.7|284/291|c.1.12.7 : ================================================:BL:SWS|13->298|PEPM_MYTED|e-113|68.2|286/295 61: . . . * . .: 120 :GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE:Sequence :cccccccccTTHHHHHHHHHHHHccccEEEEcTTccccHHHHHHHHHHHHHHTccEEEEE:Sec Str :============================================================:RP:SCP|15->298|1m1bA|2e-33|68.7|284/291|c.1.12.7 :============================================================:BL:SWS|13->298|PEPM_MYTED|e-113|68.2|286/295 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|86->168|PF00463|1e-06|37.0|81/176|ICL 121: . . + . . .: 180 :DKIFPKTNSFIGGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALR:Sequence :cccccccETcccccccEEccHHHHHHHHHHHHHHHHTcccEEEEEEcTTTccEEcccccT:Sec Str :============================================================:RP:SCP|15->298|1m1bA|2e-33|68.7|284/291|c.1.12.7 :============================================================:BL:SWS|13->298|PEPM_MYTED|e-113|68.2|286/295 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|86->168|PF00463|1e-06|37.0|81/176|ICL 181: . * . . . .: 240 :RAEAYRQAGADAILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISL:Sequence :TTGGGccTTccccTTccEEccccHHHHHHHHHHHHHHcTTccEEEEcccHHHHHHTTEEE:Sec Str :============================================================:RP:SCP|15->298|1m1bA|2e-33|68.7|284/291|c.1.12.7 :============================================================:BL:SWS|13->298|PEPM_MYTED|e-113|68.2|286/295 241: + . . . . *: 300 :VIWANHLIRVAASSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYLTG:Sequence :EEETTHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHGGGTccTTcHHHHHHHHHHH:Sec Str :========================================================== :RP:SCP|15->298|1m1bA|2e-33|68.7|284/291|c.1.12.7 :========================================================== :BL:SWS|13->298|PEPM_MYTED|e-113|68.2|286/295 : ===:BL:SWS|298->415|GLMU_DEIRA|8e-13|38.3|115/484 301: . . . . + .: 360 :GQAPSSAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYK:Sequence :HHEHHHEEEEcccccGGGccccccccGGGcEETTEEHHHHHHHHHHTTcccEEEEEEcTT:Sec Str : ======================================================:RP:SCP|307->418|1jykA|2e-27|33.9|112/229|c.68.1.13 :============================================================:BL:SWS|298->415|GLMU_DEIRA|8e-13|38.3|115/484 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|307->365|PF00483|3e-10|45.8|59/238|NTP_transferase 361: . . . * . .: 420 :AEAIDAAGIKLVRNERHAATGELASLACAADSLETDTVVSYGDLMFRSYILRDLLETDAP:Sequence :GGGTHHHTcccEEEEccccccHHHHHHHHHTTcccEEEEEETTcTccHHHHHHHHHHTcc:Sec Str :========================================================== :RP:SCP|307->418|1jykA|2e-27|33.9|112/229|c.68.1.13 :======================================================= :BL:SWS|298->415|GLMU_DEIRA|8e-13|38.3|115/484 :$$$$$ :RP:PFM|307->365|PF00483|3e-10|45.8|59/238|NTP_transferase 421: . . + . . .: 480 :FSVVVDSSESAPSNQSVRDFAWCSAADDRDLFGQKVLLRKISDTPAATDGEPHGRWIGLL:Sequence :EEEEEEEccccTTccEEEccEEEEcTTccccEcTTccEEEEEcGGGccTTGGGccEEEEE:Sec Str 481: . * . . . .: 540 :NVRGEGRARLQKLLAELRQRPDFDSLDMPDLINALVEAGEKVEVRYVHGHWRGVNDLEDF:Sequence :EEETTHHHHHHHHHHTcccccccccccTTHHHHHHHHTTccEEEEEcccGGGGcccccHH:Sec Str 541: + . . . . *: 600 :RRAGDFAHTQTPYALGNNDGETAR :Sequence :HHHHHHcTTccE :Sec Str