[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08754.1"

            "TRAP-type C4-dicarboxylate transport system, small permease component"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-------11----------------------------------------------------111-------------------------1-11-------1----2-11-------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEAPILRKRWLDHLLDVCAALGALCILAVCIVMIAMSISRETSITLKGGDDIVAWLCAAS:Sequence : $$$$$$$$$$$:RP:PFM|50->142|PF04290|1e-05|34.8|92/133|DctQ 61: . . . * . .: 120 :AFLILGQTFQHGGIVRVEMLLEAVGTKRRWLLEVISLTICLIFAGYAAWALGSFAWQSWD:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|50->142|PF04290|1e-05|34.8|92/133|DctQ 121: . . + . . .: 180 :IGDVSQGQIVIPLWIPQSFAVIGALGFLLAVGDEWLRVVRRQKPRYQLAQEAKLAAGDFG:Sequence :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|50->142|PF04290|1e-05|34.8|92/133|DctQ 181: . * . . . .: 240 :ETV :Sequence