[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08803.1"

            "short-chain dehydrogenase/reductase SDR"
            ""

OrgPattern 2211235887968765192533219448697812---------11153--622-33113133753114 IKY4t41877EA94a*oJI-Jy33d*JIJJJV****h***6oC*ULFA5HF3SLOC5C11MMY6MJcehTE11113122297S11433768627221--A7Y6DF*Da9I1111111111111144526B322673GGGKN222HCJEGI9876433442653563AJEa8134222231334EB79A661F9PHHIHIKHKGIIIIKHOHPPHPHIIBHIMMKC878896Kd855555435555554CAA9C92B1AC16121AC559A7897A9876656575744444444444444566676666667644422244475358C4444343546868825756331179322A6123224333356532G2GoGGQ22222PF*mh68DbSVVPJKLJIIKILKX-JPPLHlISZvZ2*ppOpfm***usXaGNFRNbQHNQIHQAAAAAAAAPRSC8CDA11111111111222331221222121111AHq*J9KkbQe*x****XTTUQll*yXWWWAU*d*W*xe58SUPHBJHIULeKsi9GB4C8EB6122111135ALG88M68512212422326774C4394BDECRS34133222211322322222223132477AB9BBGF9LC69C9AC8FEBAA7D7CB97D1-24448111111DFIL7N9DGGDDCCCDD-GDEEECCCDDGCFCCDDCDOWPI99BBB89AABBABBA9A9ABVABAAA8C219AAAAAA9A9AA111835323BEBD5FLPJ222526211113242NOOSPCL8E9MBSURQOVaiONNUPITPP7664465463588F87887EE8ABMPOKNJHCDF75651254FF7699--------1-4----2---2-1------31------34422565753D3 11--LDH-833-5AEajWQaUYXjfkaHHAECEHJGESKQFLNCDDPReicj**PUPHILHJB6B7764953779342354779CB3C-RlHjCeE8A88D5DKLH-EQB*TYLPJE63447H5LH4H6P*G-GHI65A4I78IB3C547F51I8BEGYbaR6YMMGDCFOESSJ5BB4o1419JHPMhRaCDAcOSND -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAERRTALVTGATKGIGLALSKHLQQLGWSVIGVARHAIEGFPGQLLTADLADIQQTDAV:Sequence :HHHcEEEEEETTTcHHHHHHHHHHHHTTcEEEEEEccHHHTcccEEEEccTTcHHHHHHH:Sec Str : =======================================================:RP:SCP|6->223|1pwxA|4e-39|18.3|218/252|c.2.1.2 : ==========================================================:BL:SWS|3->223|FABG_VIBHA|4e-30|36.7|218/244 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->157|PF00106|3e-13|41.2|153/169|adh_short 61: . . . * . .: 120 :LAQVVAASRIDAVINNAGIALPQKLESLDLPSLQTVFDLNVRAAVQVTQACLPSLKQSPA:Sequence :HHHTTccEEEEccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEGGGG:Sec Str :============================================================:RP:SCP|6->223|1pwxA|4e-39|18.3|218/252|c.2.1.2 :============================================================:BL:SWS|3->223|FABG_VIBHA|4e-30|36.7|218/244 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->157|PF00106|3e-13|41.2|153/169|adh_short 121: . . + . . .: 180 :GRIVNVCSRAIHGARDRTSYAAAKSALIGVTRTWALELAPLGITANAVAPGPVETELFRL:Sequence :cccccccccTccccccccHHHHHHHHHHHHHHHHHHHcTTcEEEEEEEcEEEcccTTccc:Sec Str :============================================================:RP:SCP|6->223|1pwxA|4e-39|18.3|218/252|c.2.1.2 :============================================================:BL:SWS|3->223|FABG_VIBHA|4e-30|36.7|218/244 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->157|PF00106|3e-13|41.2|153/169|adh_short 181: . * . . . .: 240 :THPVGSDEEKRILATIPMQRLGKPEEVASLISYLISDGASFVTGQVIGIDGGGSLGGR :Sequence :cccHcccccccHHHHHHHHHTTccccEEEEcccccccccccEc :Sec Str : XXXXXXXXXXXXXX :SEG|224->237|gqvigidgggslgg :=========================================== :RP:SCP|6->223|1pwxA|4e-39|18.3|218/252|c.2.1.2 :=========================================== :BL:SWS|3->223|FABG_VIBHA|4e-30|36.7|218/244