[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08812.1"

            "binding-protein-dependent transport systems inner membrane component"
            ""

OrgPattern 4441314266665564353332113336434212---1-----113-42-EA5-54432133314-11 -113D343444-4122322-23112A2222224333387A-A287DB536648B6324114522A5978942333633223-411112--------2--------11--122222222222222211111111121465952217B3322333221111111132215322111111111111A5433A91423666664564546445A76663655314C521222222E6155545555655556333322222452-12111--44111112234333333311112211111112222222222222231111211111C26244434541422222111143153B-111BA63--282-3462164411----1121132HHP115854B19AAA9AA8AAL-44C43A4DQP1-kQQWIJEXUMOPK4-116CEA7AA7CE1111111123322219-------------------------------11--CFBCC68888654555559955552567E64A7113342363353D5DS241142242-------111221336132352233331111111211----13111111------112222212214-1211553121111141111111211111121121--1332-------76KE3987777777777-7777777777777676776BCCCA3366666666666666666976666674-666666656666--11111111111117484441133221242322222212-135333232658154332ABA1----1---246666666656688--1-------------12111111111111116-111111-2-111--111111-1----43854AEA88212 -----------------------------------------------------------------------------------------------------------------1--------------------------------------------1----2---------1-----------1------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTYLLRRIAYALPILLGVALLCFSLVHIAPGDPLVSVLPPDASEDLRRQLTALYGFDKPF:Sequence : =========================================================:BL:SWS|4->314|Y209_BRUME|4e-59|37.8|307/315 61: . . . * . .: 120 :LEQFLHWLLRALHGDLGTSIATNRPVMSEVSVAVVNSVRLAAVATLIGFTFGCLFGFVAG:Sequence : =====================================:RP:SCP|84->315|2r6gG1|1e-11|11.7|214/284|f.58.1.1 :============================================================:BL:SWS|4->314|Y209_BRUME|4e-59|37.8|307/315 : $$$$$:RP:PFM|116->314|PF00528|4e-08|30.6|186/195|BPD_transp_1 121: . . + . . .: 180 :YLRDSVPDRVASFLSVLGVSIPHYWLGMVLVIAFSVLLGWLPATGAGPNGSGDWGWDWEH:Sequence :============================================================:RP:SCP|84->315|2r6gG1|1e-11|11.7|214/284|f.58.1.1 :============================================================:BL:SWS|4->314|Y209_BRUME|4e-59|37.8|307/315 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->314|PF00528|4e-08|30.6|186/195|BPD_transp_1 181: . * . . . .: 240 :IQYMLLPAVTMSVIPMGIVARTIRALVAEILSNEFIAGLRARGLSDLAVFRHVVKNVTPT:Sequence :============================================================:RP:SCP|84->315|2r6gG1|1e-11|11.7|214/284|f.58.1.1 :============================================================:BL:SWS|4->314|Y209_BRUME|4e-59|37.8|307/315 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->314|PF00528|4e-08|30.6|186/195|BPD_transp_1 241: + . . . . *: 300 :ALSVMGLQLGYLLGGSILIETVFSWPGTGFLLNSAIFQRDFPLLQGTILVLAVFFVMLNL:Sequence :============================================================:RP:SCP|84->315|2r6gG1|1e-11|11.7|214/284|f.58.1.1 :============================================================:BL:SWS|4->314|Y209_BRUME|4e-59|37.8|307/315 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->314|PF00528|4e-08|30.6|186/195|BPD_transp_1 301: . . . . + .: 360 :LVDALQTLFDPRIQRN :Sequence :=============== :RP:SCP|84->315|2r6gG1|1e-11|11.7|214/284|f.58.1.1 :============== :BL:SWS|4->314|Y209_BRUME|4e-59|37.8|307/315 :$$$$$$$$$$$$$$ :RP:PFM|116->314|PF00528|4e-08|30.6|186/195|BPD_transp_1