[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF08812.1 rmet0 ABF08812.1 "binding-protein-dependent transport systems inner membrane component"
MTYLLRRIAYALPILLGVALLCFSLVHIAPGDPLVSVLPPDASEDLRRQLTALYGFDKPF
LEQFLHWLLRALHGDLGTSIATNRPVMSEVSVAVVNSVRLAAVATLIGFTFGCLFGFVAG
YLRDSVPDRVASFLSVLGVSIPHYWLGMVLVIAFSVLLGWLPATGAGPNGSGDWGWDWEH
IQYMLLPAVTMSVIPMGIVARTIRALVAEILSNEFIAGLRARGLSDLAVFRHVVKNVTPT
ALSVMGLQLGYLLGGSILIETVFSWPGTGFLLNSAIFQRDFPLLQGTILVLAVFFVMLNL
LVDALQTLFDPRIQRN
//