[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF08950.1"

            "Fe(II) trafficking protein YggX"
FETP_RALME  "RecName: Full=Probable Fe(2+)-trafficking protein;"

OrgPattern -------------------------------------------------------------------- 111-------------------------------------------------------------------------------------------------------------------------------------11111----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111111111-11------------------------1111-1---------------------------111111111111111111111111111111111--11111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGGYSRPAGQLGYNSGQTNKESLMARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKE:Sequence : ccccEEccccccEEcccccccccTTHHHHHHHHccHH:Sec Str : ====================================:RP:SCP|25->100|1t07A|1e-32|46.1|76/81|d.279.1.1 : =====================================:BL:SWS|24->114|FETP_RALME|1e-52|100.0|91/91 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->110|PF04362|4e-33|69.0|87/88|Iron_traffic 61: . . . * . .: 120 :AWAGWLKHQTMLINENRLNMADPRARQYLIKQTEKYFFGDGADQAAGYVPPPAA :Sequence :HHHHHHHHHHHHHHHTTccTTcHHHHHHHHHHHHHHTTTTTccccccccc :Sec Str :======================================== :RP:SCP|25->100|1t07A|1e-32|46.1|76/81|d.279.1.1 :====================================================== :BL:SWS|24->114|FETP_RALME|1e-52|100.0|91/91 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|24->110|PF04362|4e-33|69.0|87/88|Iron_traffic