[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF08950.1 rmet0 ABF08950.1 "Fe(II) trafficking protein YggX"
MGGYSRPAGQLGYNSGQTNKESLMARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKE
AWAGWLKHQTMLINENRLNMADPRARQYLIKQTEKYFFGDGADQAAGYVPPPAA
//