[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF09080.1"

            "short-chain dehydrogenase/reductase SDR"
            ""

OrgPattern 222124589797876518353121B66B797D21---------21144--622-23112132854144 KKb7*31877F885q**VV-V*55o*VUVVVh****x***7*I*ZNGD5EC3VMQD6F11USe7XPmnrdH122231221A9Z11411679726331--C4W5HH*DdBO1111111111111148637B634898KJJOM222KEJEKK8787733332765264JKGaB121122222122KEADE661J9PGGHGHJHJGHJHIIIQHPPIPHHHBHIMKHC766675Kh855555435555554AAABDA1D29A26-11BE55AA8786A9776767776744444444444444576677787777743322233384359D5554444547755516866321199222B7123325333355523I2JuNNc11111NG*qn78EgUbcVIJJIHHJHJJV-ORYPMtNbf*l1*ppQoht****vekIPHRRaVJTXMGQ99999999YSTC7EGC111111111111233323311231211119K**QAKpfTh******XWWXSrr**aZZZCY*f*f**l49VYQJEOKJbNgQ*qAJB696CD52332222358KK9AU8E512211433425884F5485CFEETa33222312211211411111112233588CBABFFF7MB58BAAD7EDFCC9BAC9A7B1-3445A111111DIJM7M9CFFECCDCCC-FCDDDBDCECFBEBBCCBDTYTJC89BC9ABBBCBCCBABABBVAB9A98B519BBBBBBABBBB111845343DDCD4INSH111626112112353MNMQOAJ7C9QAZaWWPWbkRQQYTMURS7675566562556G65665CC79BNQQORNJDEF75652165DDA998--------1-3----2---3-1------3-------34421656763G2 11--KAM-734-7BGipaYhekUuoskLMGKHKJKGETLOGLNIHGZRXjhq**SbUKOKGJB7C5563B33AAA33233677ACA3B-RqIpLdHGDFCBBHJHG-IWE*anTSULB6D7BNAZZAXBi*U-UQZB8EDQCDUFAFBB9N5ANDQMThjlXEpXMLLGSbHXbY7DD6v444BUIXU*YfIFDZMNIG -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGNALQGRHALVTGGGRGIGAAIARRLLADGASVTLLGREQAALDATVHALQSCVIEGAA:Sequence :GGGccTcEEEEEcccccHHHHHHHHHHHTcTTccEEEEEEEccGGGTHHHHHHHHTTccT:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|14->32|gggrgigaaiarrlladga : =====:RP:SCP|56->262|1pwxA|3e-40|22.1|204/252|c.2.1.2 : ===========================:BL:SWS|34->259|ACT3_STRCO|1e-38|40.4|223/261 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->176|PF00106|1e-16|42.9|140/169|adh_short 61: . . . * . .: 120 :LGAVSADITDADWVSGAFAGATEARGPITLLVNNAGQAYSAPFGKTDLALWQRMLEVNLT:Sequence :TcEEEEEccTTcHHHHHHHHHTcTTccccEEEEcccccccccGGGccHHHHHHHHHHHTH:Sec Str :============================================================:RP:SCP|56->262|1pwxA|3e-40|22.1|204/252|c.2.1.2 :============================================================:BL:SWS|34->259|ACT3_STRCO|1e-38|40.4|223/261 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->176|PF00106|1e-16|42.9|140/169|adh_short 121: . . + . . .: 180 :GTFICTQAALPAMLEAGWGRIVNVASTAGLIGYGYVSAYCAAKHGVIGLTRSLALELATK:Sequence :HHHHHHHHHHHHHHHHTcEEEEEEEEGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGG:Sec Str : ############################# :PROS|146->174|PS00061|ADH_SHORT|PDOC00060| :============================================================:RP:SCP|56->262|1pwxA|3e-40|22.1|204/252|c.2.1.2 :============================================================:BL:SWS|34->259|ACT3_STRCO|1e-38|40.4|223/261 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|34->176|PF00106|1e-16|42.9|140/169|adh_short 181: . * . . . .: 240 :GVTVNAVCPGYTETDIVRDAVANIVGKTGRSEEQARAELAARNPQRRLVRPDEVADAVAW:Sequence :TEEEEEEEEccccccTTTTccccHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHH:Sec Str :============================================================:RP:SCP|56->262|1pwxA|3e-40|22.1|204/252|c.2.1.2 :============================================================:BL:SWS|34->259|ACT3_STRCO|1e-38|40.4|223/261 241: + . . . . *: 300 :LCQPSASAITGQAVPVAGGEVMAG :Sequence :HcccccEEEcccEEEEcccccccc :Sec Str :====================== :RP:SCP|56->262|1pwxA|3e-40|22.1|204/252|c.2.1.2 :=================== :BL:SWS|34->259|ACT3_STRCO|1e-38|40.4|223/261