[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF09165.1 rmet0 ABF09165.1 "hypothetical protein"
MSSSLITTVEKVIGKQRLSALVHDSFPAPIPKGSSASLFLSRDCLRVVAMSVTTVATNAD
TIQHRHLAGWQSGYAAACKAVYAGSIPTSASSLKQNGARCGAVLLFGLSLIQFLWDIADF
LRLLSHWLAWCACYITSGRTAFGTTLGVAIHLA
//